KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283329
Entry
DDB_G0283329      CDS       T00245                                 

Gene name
mcfO
Definition
(RefSeq) EF-hand domain-containing protein
  KO
K15105  solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ddi02000]
    DDB_G0283329 (mcfO)
Transporters [BR:ddi02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   DDB_G0283329 (mcfO)
SSDB
Motif
Pfam: Mito_carr EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4
Other DBs
NCBI-GeneID: 8623999
NCBI-ProteinID: XP_639128
dictyBase: DDB_G0283329
UniProt: Q54RB9
Position
4
AA seq 772 aa
MFANRVRQAQKLYQKRFFSLGNNSTISKQQFKNSSNNNNNKNGGNKNGFYQKAFIATTVA
LTTTLLTATTLLDDNTNSEKEILKSQRQTFEKYASTTLEGERQMTAEDFLSALTTLESDK
QSGEHEILKASLDADKFKVLFQMADVDHTGYISFDEYVMFDELMAKPEAEYFLAFKLFDR
DGNGYISKNDFKHVITASLDPSIPFNFDCELVNLYFGDGRTELNYSQFTQLLKDLQQERI
KQEFKFHDKYNSGYIPRDKFAKVLGSVKLRKIPDHVRDKLESISELNLLSGHPNEVSYSQ
FVAANDMLLHIPSYGRVLKAAILKNKKDNINKEEFLTEARSSTSIEITPLEIDLIFHLFD
LNKDGKLSISDFEKSTGLNINKIGGGTNYSDSYPSDSHVTIQNSSTTPSPSTPITNTAAA
IALNKKHGKTFAQQVLESIENFALGSIAGGIGAAAVYPIDLVKTRMQNQRAVDPAKRLYV
NSWDCFKKVVKFEGVRGLYKGILPQMVGVAPEKAIKLTVNDLLRDLFGDKSKGEIYFPLE
VLAGGFAGMSQVCVTNPLEIVKIRLQVQSTGPKVSAITIIKELGLAGLYKGAGACLLRDI
PFSAIYFPTYAKMKTILANEDGKLGPMDLLLAGAVAGIPAASLVTPADVIKTRLQVKANA
GEQTYTGIRDCFQKILKEEGPRALFKGALARVFRSSPQFGVTLVSYELLQKALLPDAEYK
PPTNAPITQKDFDVIRGNTNTVQRVIDMESKFGTLHQTRDNNKSSNGGENKN
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtttgccaacagagttagacaagcacaaaaattatatcaaaaaagatttttcagttta
ggtaataattcaacaatctcaaaacaacaattcaaaaattcaagtaataataacaacaac
aaaaatggtggtaataaaaatggattttatcaaaaagcatttattgcaacaacagtcgct
ttaacaactacacttttaacagccactacattattagatgataatacaaattctgaaaaa
gaaatccttaaaagtcaaagacaaacttttgaaaaatatgcatcaactacactcgaaggt
gaaagacaaatgacagcagaagattttttatcagcattaacaacattggaaagtgataaa
caaagtggtgaacatgaaattttaaaagcaagtttagatgcagataaatttaaagtatta
tttcaaatggcagatgttgatcatactggatatattagtttcgatgaatatgtaatgttt
gatgagttaatggcaaaaccagaagcagagtactttttagcattcaaattattcgatagg
gatggtaatggatacatttcaaaaaatgatttcaagcatgtaattacagcaagtcttgat
ccatcaattccattcaatttcgattgtgagttggtaaatctatattttggcgatggtaga
accgaattgaattactcacaattcactcaactcttgaaagatctccaacaagaacgtatc
aaacaagaattcaaatttcatgataaatataactctggttatatcccacgtgataaattc
gccaaagtattaggttctgtaaaattaagaaaaatccctgatcatgttagagataaatta
gaatcaatctctgaattaaatttactttctggtcatccaaatgaagttagttattcacaa
tttgttgctgcaaatgatatgttattacatattccatcatatggtagagttttaaaagct
gcaattttaaaaaataaaaaagataatattaataaagaagaatttttaacagaagcaaga
tcatcaacatcaattgaaattacaccattagaaattgatttaattttccatctattcgat
ttaaataaggatggtaaattaagtatttcagattttgaaaaatcaacaggattaaatatt
aataagattggtggtggtacaaattatagtgattcatatccaagtgatagtcatgttact
attcaaaatagttcaacaacaccatcaccatcaacaccaattactaatacagcagcagca
atagctttgaataagaaacacggtaaaacatttgcacaacaagtattggaatcaattgaa
aactttgcattaggttcaattgctggtggtattggtgccgctgcagtttatccaatcgat
ttggtaaagactagaatgcaaaatcaaagagcagtagacccagccaaaagattatatgta
aacagttgggattgtttcaaaaaggtggtaaaattcgaaggtgttagaggtttatacaaa
ggtattctcccacaaatggttggtgttgcaccagagaaggcaattaaattgacagtaaac
gatttacttcgtgatttgtttggtgataagagtaaaggtgagatctacttcccattagag
gttttggctggtggtttcgctggtatgtcacaagtttgtgtcaccaatccattggagatt
gtaaagattcgtcttcaagttcaatcaactggtccaaaggttagtgccatcaccatcatt
aaggagttgggtttagctggtctctacaagggtgctggtgcttgtctccttagagatatc
ccattctctgctatttatttcccaacttacgctaaaatgaaaactattctcgccaatgaa
gatggtaaattaggtccaatggatcttttattggctggtgctgtcgctggtattccagct
gcaagtttggtaactccagccgatgtcattaaaactagacttcaagtaaaagcaaacgct
ggtgaacaaacttacactggtattcgtgattgtttccaaaagattctcaaagaagaaggt
ccacgtgctctcttcaagggtgcccttgctcgtgttttcagatcttccccacaatttggt
gtaactttagtctcctatgaattactccaaaaagctttacttccagacgctgaatataaa
ccaccaacaaatgctccaatcactcaaaaagatttcgacgtaattagaggtaatacaaat
actgttcaaagagttatcgatatggaaagtaaatttggtactcttcatcaaactcgtgat
aataataaatcatcaaatggtggtgaaaataaaaattaa

DBGET integrated database retrieval system