KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283585Help
Entry
DDB_G0283585      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: Dicty_spore_N Collagen
Motif
Other DBs
NCBI-GeneID: 8624130
NCBI-ProteinID: XP_639000
dictyBase: DDB_G0283585
UniProt: Q54QY4
Position
4
AA seq 1424 aa AA seqDB search
MIINKLCIIFIFLTALIFQAHSLSDIDCEALDENSCKGNNECLYLPFVGCCGESKFYCVK
NQGNCFDNRLSCGRNINTGKIFEFWSVCKPQKDFKDFSPSNQTCDSLKCEEKGFTCKWIE
PNCYGTSCCTREPKCFDQDDNIVDPQKQQKQQQCACQPNNGNGNNGNNGNNGNNGNNGNN
GNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGSNGNNGNNGNN
NNQFDCENVENQDQCQSNYPKCKWLSYPGCCGDQISRCVNDPNNNCYDNQLSCATHVETN
KIYEIWSTCKPQKGFKQYFPSNVTSCSQLDCESKGMDCAWSTDNKCLSTHCCQNTPKCVP
KNDNNGNGNNVNNNNNNNGNNNNNNNGNGNNNNGNNNNNGNGNNNGNNGNNGNNNNNNNN
HGGNGNNGNVDCENVTNQDQCQSNYPKCKWLTYPGCCGDQISRCVNDPNNNCYDNQLSCA
THVETNKIYEIWSTCKPQKGFKQYFPPNMTSCSQLDCESKGMDCKLSQDDGCLNTHCCQK
TLRCVPKNNGNGNNGNNGNGNNGNNGNTGNNGNNGSNGNNGQSTGGMVTTSGMATTGGMA
TNGGSSVSSSGNNGNNGNNGNGNNGNNNNNQIVDCENVTNQDHCQLNYPKCKWLTYPGCC
GDQISRCVNDPNNNCYDNQLSCATHVETNKIYEIWSTCKPQKGFKQYFPPNITSCSQLDC
ESKGMDCKLSQDDGCLNTHCCQKTLRCVPKNNGNGNNGNGNTGNNGNTGNNGNTGNNGNT
GNTGNNGNTGNNGNTGNNGNTGNTGNTGNGNNGNTGNNGNTGNGNTGNTGNNGNGGSTSS
PEPALATITIATGGNNHQSTGGTGTIGGSASTSTSSGGNTGHNGNTGNNGNTGNNGNGGS
TSSPEPALATITIATGGNNHQSTSGAGTTGGSASTSTSSGGNNGNNGNGGSTSSPTPALA
TITIATSGNNHQSTGGAGTTGGSASTSTASSGNGNNGNGNNGSTGHNGTNGNGGSTSSPT
PALATITIATSGNNHQSTGGTGTTGGSASTSTSSGNTGNGNNGNNGNTGNNGNNGNGGST
SSPEPALATITIATSGNNHQSTGGTGTTGGSASTSTSNGNNGNGNNGNTGNNGNTSNNGN
TGNNGNGGSTSSPEPALATITIATSGNNHQSTGGTGTTGGSASISSSSSGSSSSGSSTSG
SSSSGSSTSGSSTSGSSTSGSSTSGSSSSNNGGSGTGDNEPKFASITILTSGHHTSGSST
TGGSATSSTTTSSTSHSNTGSVHGNKRSAYGAGWGSGPNFSATNVDNVMEMQNGGNEVNE
NNEYFEAQNGQTNENNQNYNQNNENYNTNRDWLSQQQGYWYTRSSPDGSLEIHIPENYND
YERQIFDQSGSIGRSRENSYDDTPKNPYSGPYGDNSSQSKATTN
NT seq 4275 nt NT seq  +upstreamnt  +downstreamnt
atgattatcaataaactttgtatcatttttatttttttaacagctttaatattccaggcg
cattctttaagtgatatagattgtgaagctttagatgaaaattcatgtaagggtaataat
gaatgtctttatttaccatttgttggatgttgcggcgagagtaaattctattgcgtaaag
aatcaaggaaactgttttgacaatcgtttatcttgtggtagaaatataaatactggtaaa
attttcgaattttggtcagtatgtaaaccacaaaaggatttcaaagatttttcaccatcc
aatcaaacatgtgactctttaaaatgtgaagaaaaaggtttcacttgtaaatggattgaa
ccaaattgttacggtacatcatgttgtactcgtgaaccaaaatgttttgatcaagatgat
aacatagtagatccacaaaaacaacaaaaacaacaacaatgtgcatgtcaaccaaataat
ggtaatggtaataatggtaacaatggtaacaatggtaacaatggtaacaatggtaataat
ggtaacaatggtaacaatggtaacaatggtaacaatggtaacaatggtaataatggtaat
aatggtaataatggtaacaatggtaataatggtaacaatggtaataatggtaacaatggt
aataatggtaacaatggtaataatggtagcaatggtaataatggtaacaatggtaacaat
aataaccaatttgattgtgaaaatgttgaaaatcaagatcaatgtcaatcaaattatcca
aaatgtaaatggttatcatatccaggatgttgtggtgaccaaatttcaagatgtgtaaat
gatccaaataataattgctatgataatcaactctcatgtgcaactcatgttgaaaccaat
aaaatatatgaaatctggagtacttgtaaaccacaaaaaggattcaagcaatatttccca
tcaaatgttacatcttgttcacaacttgattgtgaaagtaaaggtatggattgtgcatgg
tcaacagataataaatgtttgagcacccattgctgtcaaaatacaccaaagtgtgttcca
aagaatgataataatggaaacggaaataatgttaataataataataataataatggaaat
aataataataacaataacggtaatggtaacaataataatggtaataataacaataatggt
aatggtaataacaatggtaataatggtaataatggaaataataataataataataataac
catggtggtaatggaaataatggtaacgttgattgtgaaaatgttacaaatcaagatcaa
tgtcaatcaaattatccaaaatgtaaatggttaacatatccaggatgttgtggtgaccaa
atttcaagatgtgtaaatgatccaaataataattgctatgataatcaactctcatgtgca
actcatgttgaaaccaataaaatatatgaaatctggagtacttgtaaaccacaaaaagga
ttcaaacaatatttcccaccaaacatgacttcatgttctcaacttgattgtgaaagtaaa
ggtatggattgcaaattatcccaagatgatggttgtttaaatactcattgttgtcaaaaa
acattgagatgtgtgccaaagaataacggtaatggtaacaatggtaataatggtaatggt
aacaatggtaataacggtaatactggtaataatggtaataacggtagcaatggtaataat
ggtcaatcaactggtggaatggttacaactagtggaatggctacaactggcggaatggct
acaaatggtggatcttcagtatcatcaagtggtaataatggtaataatggtaacaatggt
aatggaaataatggtaataacaacaataaccaaatagttgattgtgaaaatgttacaaat
caagatcattgtcaattaaattatccaaaatgtaaatggttaacatatccaggatgttgt
ggtgaccaaatttcaagatgtgtaaatgatccaaataataattgttatgataatcaactc
tcatgtgcaactcatgttgaaaccaataaaatatatgaaatctggagtacttgtaaacca
caaaaaggattcaagcaatatttcccaccaaacattacatcatgttctcaacttgattgt
gaaagtaaaggtatggattgcaaattatcccaagatgatggttgtttaaatactcattgt
tgtcaaaaaacattgagatgtgtgccaaagaataacggtaatggtaataatggcaatggt
aatactggtaataatggtaatactggtaataatggtaatactggtaataatggtaatact
ggtaatactggtaataatggtaatactggtaataatggtaatactggtaataacggtaat
actggtaatactggtaatactggtaatggtaataatggtaatacaggcaacaatggtaat
actggtaatggtaataccggtaatactggcaacaatggaaatggaggaagcacaagttcg
ccagaaccagcattagcaacaattacaattgcaacaggtggcaataaccatcaatctaca
ggtggaacaggtacaataggtggatctgcttcaacatcaacatcatcaggcggtaatacc
ggacataatggtaatactggtaataatggtaatacaggcaataatggaaacggaggcagc
acaagttcaccagaaccagcattggcaacaattacaattgcaactggcggtaataaccat
caatctacaagtggagcaggtacaactggtggatctgcttcaacatcaacctcatcaggc
ggtaataatggtaataatggaaatggaggcagcacaagctcaccaaccccagcattagca
acaattacaattgcaactagcggtaataaccatcaatctacaggtggggctggtacaact
ggtggatctgcttctacatcaacagcatcaagtggtaatggtaataatggaaatggaaac
aatggtagcaccggacataatggtactaatggaaacggaggcagcacaagttcacctacc
ccagcattagcaacaatcacaatcgcaactagtggtaataaccatcaatctacaggtgga
acaggtacaactggtggatctgcttcaacatcaacatcaagtggtaataccggaaatgga
aacaatggtaataatggtaatactggcaataatggtaataatggaaatggaggcagcaca
agttcaccagaaccagcattagcaacaattacaattgcaactagtggtaataaccatcaa
tctacaggtggaacaggtacaacaggtggatcagcttcaacatcaacatcaaatggtaat
aatggaaatggaaacaatggtaataccggtaataatggtaataccagtaataatggtaat
accggtaataatggaaatggaggtagcacaagttcaccagagccagcattagcaacaatt
acaattgcaactagtggtaataaccatcaatctacaggtggaacaggtacaactggtgga
tctgcttcaatatcctcttcatcttcaggttcctcatcttcaggttcttcaacttcaggt
tcttcatcttcaggttcttcaacttcaggttcttcaacttcaggttcttcaacttcaggt
tcttcaacttcaggttcttcctcatcaaataatggtggaagtggtactggagataatgaa
ccaaaatttgcctcaattacaattttaactagtggacatcatactagtgggtcaagtaca
actggtggatcagccacatcttcaacaaccacatcttcaacatcacatagtaatactgga
tcagtacatggaaataaacgtagtgcatatggtgcaggttggggatcaggtccaaacttt
tcagcaaccaatgtagataacgttatggaaatgcaaaatggtggaaatgaagtaaatgaa
aacaatgaatactttgaagcacaaaatggacaaaccaatgaaaacaatcaaaattataat
caaaacaatgagaattacaacacaaacagagattggttatcacaacaacaaggttattgg
tatactagatcctcaccagacggttcattagaaattcatattccagaaaactataatgac
tatgaaagacaaatatttgaccaatctggtagtataggtcgttctcgtgagaattcttat
gatgatacccctaaaaatccatatagtggtccatatggtgataactcttctcaatctaaa
gcaaccacaaattaa

DBGET integrated database retrieval system