KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283621
Entry
DDB_G0283621      CDS       T00245                                 

Gene name
cutA
Definition
(RefSeq) fatty acid elongase 3-ketoacyl-CoA synthase
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0283621 (cutA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     DDB_G0283621 (cutA)
SSDB
Motif
Pfam: FAE1_CUT1_RppA Chal_sti_synt_C ACP_syn_III_C Chal_sti_synt_N BPD_transp_1 ACP_syn_III FlgD
Other DBs
NCBI-GeneID: 8624177
NCBI-ProteinID: XP_638938
dictyBase: DDB_G0283621
UniProt: Q6TMJ4
Position
4
AA seq 516 aa
MVEEKKTTQATPRVEEEVKSYYYPDRDADMEEVGRGYSIWRNNTFRTMVLGLTPLVIINF
IYLYNNSAILIDIFDKFQTMVLEEMSNQDPTNIYIIITLAFLSLLGLELVISVFLSKRRR
EVYLVDFSVFQPPEQYKISHEFFVEHTKSVGWFDQDSVDFQTKLLYRTGLGNETYFPAGI
TKKSPDVSMESAREEAQLVLSGCLDSLFAKTGLKPQEIDILIVNCSLFNPTPSLAAMMMN
RYKMRSDVLSYNLSGMGCSAGAISIDLAKQLLQVHKNATAVVLSTENITQNWYRGNERAM
LVTNTLFRMGGAAIMLSNKSKYYWTGKYRLVASVRVTKCHDAAYNAVYQTEDNKGNKGVR
LATGRDLMTVVGDCMKTNFTILGPMVLPWSEQIKFFVNFCHRKLVGGKKVPAYVPNFKKA
FQHFCIHAGGRAVIDGLEENFNLSPYDVEPSRATLYRYGNTSSSSIWYELNFIEKQHSVK
CGEKVLQLSFGSGFKMNSLVWQSIRDIGPSKKKKLN
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggtagaagaaaagaaaactactcaagcaacaccaagagttgaagaggaagttaaatca
tattattatccagatagagatgcagatatggaagaggttggacgtggatattcaatatgg
agaaataatacattccgtactatggtattaggattaacaccattggttataataaatttc
atttacctctataataatagtgctatattaattgacattttcgataaatttcaaaccatg
gtattggaagagatgtcaaatcaagatccaaccaatatttacattataataacattggca
ttcttgtcattattaggattggaattggtaattagtgtatttttatcaaagagaagaaga
gaggtttacttggttgatttcagtgtattccaaccaccagagcaatacaaaatttcacat
gaattctttgttgagcatacaaagagtgtcggatggttcgatcaagattcagtggatttc
caaactaaattattgtatcgtacaggtttgggtaatgagacttacttcccagcaggtatc
accaaaaagtcaccagacgtatcgatggagagtgcacgtgaggaggctcaattggtgttg
tcaggctgtttggattcattgtttgcaaagactggtttgaaaccacaagagatcgatatc
ctcattgtcaattgctcccttttcaatccaacaccatcactcgctgcaatgatgatgaat
agatataagatgcgttcagatgttttaagttataatctatctggtatgggttgttctgct
ggtgcaatctctattgatttggctaaacagttattacaagtccacaagaatgccaccgcc
gttgtattatccaccgagaatatcacacaaaattggtatcgtggtaatgaaagagcaatg
ttggtcaccaataccctcttccgtatgggtggtgctgcaattatgttatccaataaatca
aaatactattggactggtaaatatcgtttggtcgcaagtgttcgtgtcactaaatgtcac
gatgccgcctacaatgccgtataccaaaccgaggataataaaggtaacaaaggtgttaga
ttggcaacaggtagggatttaatgactgtggttggtgattgtatgaaaactaatttcact
atcttgggtccaatggttttaccatggagtgaacaaatcaaatttttcgtaaacttttgt
catagaaaattggttggtggtaaaaaagtacctgcatacgtaccaaactttaaaaaagct
ttccaacatttttgtattcatgctggtggtcgtgccgtcattgacggtctcgaagagaac
tttaatctctctccatatgatgttgaaccttcaagagctaccctctatcgttatggtaac
acctcttcttcctcaatttggtatgaattaaactttatcgaaaagcaacattcagttaaa
tgtggtgaaaaagttttacaattaagttttggtagtggtttcaaaatgaactctttagtt
tggcaatcaattagagatattggtccatcaaaaaaaaagaaattaaattga

DBGET integrated database retrieval system