KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283651
Entry
DDB_G0283651      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Tyrosinase Flagellin_D3
Other DBs
NCBI-GeneID: 8624181
NCBI-ProteinID: XP_638942
dictyBase: DDB_G0283651
UniProt: Q54QT1
Position
4
AA seq 816 aa
MSEGSTSITNSPIFKKNKPNLPTNLAKSESSSDSSSLQDAFAPPPPLTFGHQNNDLRRVR
KNAAHLSEEERNKFLVAIVGLKNKYPNNSKYSVYDQFVILHMGAVSLARKSEYDEKDLDV
YNNNKLKVDPGHGNPAFLSWHRMLLNKFENALQTIDPSVTLPYWDWTDRDASTNNIFIKE
FMGGNGGIEGLGGKIVNSVFTSENGFYVREELHKASKAENSLGNTVVRYLGPFDFLATPQ
SEFKEFMCSNTFSPSAVIIDPSTKRVKPGDDTNRGFRIGVEAGLKAHNPTHDWYGYGSGA
QMPQQLQVDQSKIKDKDPADVVWKTQEIYSSISTMTNVACSNNDPIFWLHHCNIDRLWAD
WQDQGHFGDMYFPKKGRDSFQVVNDKTAEPYSYPWGHNLDDPLWPWDNSLSFTVPWLQES
LPICYSHYESKDVIDFRSLGYQYDTSSTIAFNAKPVKAFPNGQSKQVFKFNINSIKSESY
YFVFNSIGNAIINDISIHTQYNENDINEWDFQTKGFTGSQLNKPPVKHSKGGTIDKVSFE
AKRGTYYVVVSSNGNADINSYYTIAIKDSDPQLLQTGYQGIISFGLKETDPTIQEKDVVA
KIKGTKEFFFVYVKELCNLSFKVKGIDALIQIIGPSTSTDIIGLDEGCCKNTCPSVSATL
TPGHYLIQLFHCSYNDQIGRTGKLEIKYSTDNIENKVKTIESGSSITENIPESGTVLYKI
QTESNIVDTLHVFRVGLNSFSSCTEVNTSVYETVTKTTDPYGYDCVSSVIASGKQESICD
LQNSIDNTKTYYVRVSFPQAPHIDSTDKFTLKFKAF
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcagaaggttcaacttcaattacaaattcaccaatttttaaaaagaataagccaaat
ttaccaacaaacttggcaaaatctgaatcttcatcagactcttcttcccttcaagatgct
tttgcaccaccaccaccattaacttttggtcatcaaaataatgatcttagaagagttaga
aaaaatgctgctcatttaagtgaggaagaaagaaataaattccttgttgcaattgttggt
ttaaaaaataaatatccaaacaattctaaatactctgtctatgatcaatttgtaatatta
catatgggtgctgtttcacttgctagaaaatctgaatatgatgaaaaagatttagatgtt
tataataataataaattaaaagttgatccaggtcacggtaatccagcatttttatcatgg
catagaatgttattaaataaatttgaaaatgcattacaaacaattgatccatctgttact
ttaccatattgggattggactgatagagatgcttcaacaaataatatatttattaaagaa
tttatgggtggtaatggtggcattgagggtctaggtgggaaaatagttaactcagttttt
acaagtgaaaatggattttatgttagagaagaattacataaagcatctaaagctgaaaat
tcgttaggtaatactgttgttagatatttaggaccatttgactttttagcaacaccacaa
agtgaatttaaagaatttatgtgttcaaatacttttagtccaagtgcagttataattgat
ccatcaacaaaaagagtaaaaccaggagatgatactaatagaggttttagaattggtgtt
gaagctggtttaaaagctcataatccaactcatgattggtatggttatggttctggtgct
caaatgccacaacaattacaagttgatcaaagtaaaattaaagataaagatccagccgat
gttgtatggaaaacccaagaaatctattcgagtatttcaacaatgacaaatgttgcatgt
tctaataatgatccaatcttttggttacatcattgtaatatcgatagattatgggcagat
tggcaagatcaaggccactttggagatatgtatttcccaaagaaaggtcgtgattcattc
caagtcgttaatgataaaaccgccgaaccatattcttatccatggggtcataatttagat
gatccactttggccatgggataattcactttcatttactgtaccatggttacaagaaagt
ttaccaatttgttattcacactatgaatcaaaggatgtaattgattttagatcacttggc
tatcaatatgatacaagttcaacaattgcattcaatgctaaaccagttaaagcattccca
aatggtcaaagtaaacaagttttcaaatttaacattaattcaattaaatcagaaagttat
tactttgtattcaattcaataggtaatgctataatcaatgacatttcaattcatactcaa
tataatgaaaatgatattaatgaatgggatttccaaactaaaggttttactggttctcaa
ttaaataaaccaccagttaaacattccaaaggtggtacaattgataaggtttcatttgaa
gcaaagagaggtacctattatgttgttgtttcaagtaatggtaatgccgatattaattca
tactatacaattgcaattaaagatagtgatccacaacttttacaaactggttatcaaggt
atcattagtttcggtctaaaagaaactgatccaacaattcaagaaaaagatgttgttgct
aaaattaaaggtacaaaagaattcttctttgtatacgttaaagaactttgcaatttaagc
ttcaaagttaaaggtatcgatgcattaattcaaataattggtccatcaacttcaactgat
atcataggtcttgatgaaggatgttgtaagaatacttgcccatcagtttcagcaactctc
acaccaggtcattatttaattcagctattccattgtagttacaatgatcaaattggtaga
actggtaaattagaaattaaatattccactgataatattgaaaataaagtcaaaaccatt
gaatctggttcatcaataactgagaatattccagaatctggtacagttttatataaaatt
caaactgagagtaatattgttgatacattacatgtttttagagttggtttaaattcattc
tcaagttgcactgaagttaatacatcagtttatgaaactgtaacaaaaacaactgatcca
tatggttatgattgtgtttcatctgttatcgcatctggtaaacaagaatcaatctgtgat
cttcaaaattcaattgataatacaaaaacttattatgttcgtgtatcattcccacaagct
cctcatatcgattcaactgataaatttactcttaaatttaaagcattttaa

DBGET integrated database retrieval system