KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283663
Entry
DDB_G0283663      CDS       T00245                                 

Gene name
ppiD
Definition
(RefSeq) cyclophilin-type peptidylprolyl cis-trans isomerase
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0283663 (ppiD)
Enzymes [BR:ddi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     DDB_G0283663 (ppiD)
Chaperones and folding catalysts [BR:ddi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    DDB_G0283663 (ppiD)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_12 TPR_8 TPR_11 TPR_19 TPR_6 TPR_17 ANAPC3 DUF3856 TPR_9 TPR_20 DUF3808
Other DBs
NCBI-GeneID: 8624190
NCBI-ProteinID: XP_638951
dictyBase: DDB_G0283663
UniProt: Q54QS2
Position
4
AA seq 354 aa
MTSENKRVYFDIEIGGNKVGRIVMELFFDKTPKTAENFRALCTGEKGIGKNGKPLSYKGS
GFHRVIKQFMIQGGDFTAGNGTGGESIYGEKFDDENFIAKHTKAGLLSMANSGPGTNGSQ
FFITTISTPHLDNKHVVFGKVIKGMSVVREIESQPTGANDKPIKDCIIMDCGELKEGEDD
GVPEKTGDDKWEDYPQDDNVEGNEANLKVGEAIKNIGNDYFKQGKSLEAIAKYNKALRYL
DCCSNIDGLKNVQTICYNNMSQCYLKEKKGSNALVAAKKALELSPNDIKALFRKAKALSL
MEEYDEAIKDFQKIIETDSENKDAKLELERIKKLQKAKDLKSAKAYSKLFSDDD
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacaagtgaaaataaaagagtttattttgatattgaaattggtggtaataaagttggt
agaattgttatggaattattctttgataaaacaccaaagacagcagaaaatttcagagca
ttatgtactggtgaaaaaggtattggaaagaatggtaaaccattatcttataaaggttca
ggttttcatcgtgttattaaacaatttatgattcaaggtggtgattttacagctggtaat
ggtactggtggtgaatcaatttatggtgaaaaatttgatgatgaaaatttcattgcaaaa
catactaaagctggtcttttaagtatggcaaattcaggtccaggtacaaatggtagtcaa
ttctttattactacaattagtacaccacatttagataataaacatgttgtatttggtaaa
gttattaaaggaatgagtgttgttagagaaattgaaagtcaaccaacaggagcaaatgat
aaaccaattaaagattgtattattatggattgtggtgaattaaaagaaggtgaagatgac
ggtgtaccagagaaaactggtgatgacaaatgggaagattatccacaagatgataatgtt
gaaggtaatgaagcaaacttaaaagttggtgaagccattaaaaacattggtaatgattat
tttaaacaaggtaaatcattagaagccatagccaaatacaataaagcattaagatattta
gattgttgtagtaatatcgatggtttaaagaatgttcaaaccatttgttataataatatg
tcacaatgttatttaaaggaaaaaaaaggttccaatgctttggtagctgcaaaaaaagca
ttagaattatcaccaaatgatattaaagcactctttagaaaagctaaagctttatcttta
atggaggaatatgatgaagctatcaaagatttccaaaaaatcattgaaaccgattccgag
aataaagatgcaaaacttgaattagaaagaattaaaaaattacaaaaagcaaaagatctt
aaaagtgccaaagcttattcaaaacttttttctgatgatgattag

DBGET integrated database retrieval system