KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283757
Entry
DDB_G0283757      CDS       T00245                                 

Symbol
rab1A
Name
(RefSeq) Rab GTPase
  KO
K07874  Ras-related protein Rab-1A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0283757 (rab1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0283757 (rab1A)
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0283757 (rab1A)
Membrane trafficking [BR:ddi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    DDB_G0283757 (rab1A)
 Autophagy
  Other autophagy associated proteins
    DDB_G0283757 (rab1A)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0283757 (rab1A)
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0283757 (rab1A)
  Exosomal proteins of colorectal cancer cells
   DDB_G0283757 (rab1A)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    DDB_G0283757 (rab1A)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA Gtr1_RagA SRPRB FeoB_N AAA_22 AAA_29 AAA_5 AAA_16 AAA_7 TniB
Other DBs
NCBI-GeneID: 8624312
NCBI-ProteinID: XP_638915
dictyBase: DDB_G0283757
UniProt: P34139
Position
4
AA seq 202 aa
MNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVG
NKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRLTASQPTQ
TVDKNKVVPGSSAPISPKSGCC
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaacccagattatcattatttatttaaattacttttaatcggtgatagtggtgtaggt
aaatcatgtcttttacttagatttgctgatgacacttattcagaaagtttcatctcaaca
attggtgtcgatttcaagattagaactatcgaattaaatggtaaaaccattaaattacaa
atttgggatactgcaggacaagaaagatttagaacaattacatcatcatattatcgtggt
gcccatggtatcattgttgtttatgatgtaactgataaattaacatttgaaaacgttaga
caatggttacaagaaattgatagatttgcatgcgaaaatgtaaataaacttttagttgga
aacaagagtgatcttgtcgctaaaaaagttgtagatttcaataccgccaaagcttttgcc
gactctcttcaaattcctttcctcgaaacctctgcaaaacaatcaacaaacgtagaacaa
gcatttatgacaatggccactgaaattaaaaatagattaacagcttctcaaccaactcaa
accgttgataaaaataaggttgtaccaggttcctctgctccaatctctccaaaatctggt
tgttgttaa

DBGET integrated database retrieval system