KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284023
Entry
DDB_G0284023      CDS       T00245                                 

Gene name
bzpL
Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Motif
Pfam: bZIP_1 bZIP_2 DUF4291
Other DBs
NCBI-GeneID: 8624379
NCBI-ProteinID: XP_638790
dictyBase: DDB_G0284023
UniProt: Q54Q90
Position
4
AA seq 530 aa
MYSPSSPQSSEPMSPESDYGGGNSINNSNSSNNSSANQSPQFSVGKMKVDSEEKVKKRQV
RLLKNRQSAALSRSRKKEYIANLESKAQELTHSTQELHVQYNKISSTTFETKSRLEFLEK
SLRSLRMENEFLRTKFEDINNNNIKSHSRSNSSSSSLSSSPTTPNTTTTTTTSTTPVQLI
INNHKSESSPLLLNSTNSSPTIASTLINTKDIINVSQNKNNNNNNNNNNNNNNNNNNNNN
NNNNTTNLLDQQQQSPTPVLESLIKKDREREILIGINKINHFKFNNNNINNINNINNNNN
NINNIVNDEEDEEKCKINSVEESNSNHLNNNFSNLSFSSPNVNSQPIYLTRVRSSSYHPS
NYLGMESPTINAGHHMIIPTESLILSSNHHHHHHNNINNNSNNHYHHESSTASSSSGGNK
LPSLYSITNNLGGGNSSSPSSSSTSSPSTSSPSTPKSMGFPSPIFIGSSGSGPSSSGSQI
NHRSSIIGLSKLKSYNNNNNSNNNNSPILYPISTNQYPSLINNNNNNNNY
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtacagtccatcatcaccacaaagcagtgagccaatgtcaccagaatctgactatgga
ggaggtaatagtatcaataatagtaatagtagtaataatagcagtgccaatcaatcacca
caattttcagttggaaaaatgaaagttgattctgaagaaaaagttaaaaagagacaagta
agattattaaagaataggcaatctgcagccttatcaagatcaagaaagaaagaatatatt
gcaaatttagaatcaaaagcacaagaattaacacactcaacccaagaattacacgttcaa
tataataaaatttcctcaaccacttttgaaaccaaatcacgtttagaatttttagagaaa
agtttaagatcattgagaatggaaaatgaatttttaagaacaaaatttgaagatataaat
aataataatataaaatcacattcacgttcaaattcatcatcatcatcattatcatcatca
cctaccactcctaatactaccactaccaccactacatcaaccacccctgtacaattaata
atcaataaccataaatcagaatcatcacctttattactaaattcaacaaattcatcacca
acaattgcttcaacattaattaatacaaaagatattattaatgtatcacaaaataaaaat
aataataataataataataataataataataataataataataataataataataataat
aataataataatacaaccaatctattagatcaacaacaacaatcaccaacaccagtttta
gaatcattaataaaaaaagatagagaaagagaaattttaattgggataaataaaataaat
cattttaaatttaataataataatataaataatataaataatataaataataataataat
aatataaataatatagtaaatgatgaagaagatgaagaaaaatgtaaaattaatagtgta
gaggagagtaatagtaatcatttaaataataatttttcaaatttaagtttttcatcacca
aatgtaaattctcaaccaatctatttaactagagtaagatcatcatcttatcatccatca
aattatttgggaatggaatcaccaactattaatgctggccatcatatgataataccaact
gaaagtttaattttatcttcaaatcatcaccaccatcatcataataatattaataataat
agtaacaatcattatcatcatgagtcttctactgcatcatcgtcatcgggtggaaataag
ttaccatcattatattcaattacaaataatttaggtggtggtaattcatcatctccatca
tcttcatcaacttcatcaccatcaacttcatcaccatcaacaccaaaatcaatgggtttt
ccatctccaattttcattggttcatccgggtctggaccatcttcatcaggttctcaaatt
aatcatagatcttcaattataggtttaagtaaattaaaatcttataataataacaataat
agtaataataataattctccaattctttacccaatttcaacaaatcaatatccttcatta
ataaataataataataataataataattattaa

DBGET integrated database retrieval system