KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284407
Entry
DDB_G0284407      CDS       T00245                                 

Gene name
erg24
Definition
(RefSeq) Delta-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00100  Steroid biosynthesis
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DDB_G0284407 (erg24)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DDB_G0284407 (erg24)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8624584
NCBI-ProteinID: XP_638613
dictyBase: DDB_G0284407
UniProt: Q54PP1
Position
4
AA seq 462 aa
MSAVRNRNNVEKQSNNGAQLTEVQKKELADLQKVHPANEFGGIIGTFLLTFILPVVVYWI
WASIEFNNGYLLRPETLSVEGVKAFLAQLYHYVITYAYPTKEAAIIYFSWFGFQAFLQHV
VPGRKVLGSPLPGGARLEYTLNGWASWWITLIVIPIAIYFGLFKATILIDNYAPMMTVVN
IWSFVFTFLLKIHAKLKGEEERMSGHFFYDFWMGFARNPRIGSFDLKLFCEARPGLILWV
LMNFSIAAKQLEVYGEISLSVILVCCFHFWYIADYYYHEEAILTTMDIITEKFGYMLVYG
DLSWVPFTYCFQCYYLYKHLVNGAPLHISIGYAIFVVSLKCFGFYLFRWVNSQKHDFRRN
PEAPVWGKPAEFILTKRGTKLLCSGFWGICRHLNYTGDIILSWAWCLPCQFDSLAPYFYG
IYFTSLDLHRCWRDHNACLVKYGDDWRAYCKRVPYNFIPGLI
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcagcagttagaaatagaaataacgttgaaaagcaatcaaacaatggtgctcaatta
acagaagtccaaaagaaagaattagccgacttacaaaaagttcatccagctaatgaattc
ggtggtattattggtaccttcctcttaacttttattctcccagttgttgtctattggatt
tgggcatcaattgaattcaacaatggttatctcttacgtccagaaaccctttcagtcgaa
ggtgtcaaagcattcttggctcaactctaccactatgtcatcacttacgcctacccaacc
aaagaagcagccatcatctacttctcatggtttggtttccaagcattccttcaacacgtt
gttccaggtcgtaaagttttaggttcaccattaccaggtggtgctcgtctcgaatacacc
ctcaatggttgggcttcatggtggatcacactcattgtcatcccaattgccatctatttc
ggtctcttcaaagccaccatcctcattgacaactacgccccaatgatgaccgtcgtcaac
atttggtcctttgttttcactttcctcttaaaaatccacgccaaattaaagggtgaagaa
gaacgtatgtcaggtcacttcttttacgatttctggatgggttttgctcgtaatccacgt
atcggttcattcgatctcaaacttttctgtgaagctcgtccaggtctcatcctttgggtt
ttaatgaatttctcaattgctgccaaacaactcgaagtctacggtgaaatttcactctct
gtcatcttggtttgttgtttccacttctggtacattgccgattactattatcacgaagaa
gccatccttaccactatggatatcatcactgaaaaattcggttacatgttagtttatggt
gatttatcatgggtcccattcacctattgtttccaatgttactacctctacaaacattta
gtcaacggtgctccattacacatctctattggttacgccatctttgttgtctctttgaaa
tgtttcggtttctatctcttccgttgggttaactcacaaaaacacgatttccgtcgtaat
ccagaagctccagtttggggtaaaccagctgaattcatcctcaccaaacgtggtactaaa
ttattatgctctggtttctggggtatttgccgtcatcttaactacactggtgatattatc
ttatcatgggcttggtgtcttccatgtcaattcgattcacttgctccatacttttatggt
atttactttacttcattagatctccaccgttgttggagagatcataatgcttgtttagtt
aaatatggtgatgattggagagcttattgtaaacgtgttccatacaatttcattccaggt
ttaatttaa

DBGET integrated database retrieval system