KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284553
Entry
DDB_G0284553      CDS       T00245                                 

Gene name
gmd
Definition
(RefSeq) GDP-mannose 4,6-dehydratase
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00051  Fructose and mannose metabolism
ddi00520  Amino sugar and nucleotide sugar metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DDB_G0284553 (gmd)
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0284553 (gmd)
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     DDB_G0284553 (gmd)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 TAA-Trp-ring CCDC158
Other DBs
NCBI-GeneID: 8624624
NCBI-ProteinID: XP_001134543
dictyBase: DDB_G0284553
UniProt: Q1ZXF7
Position
4
AA seq 356 aa
MSEERKVALITGITGQDGSYLTEFLISKGYYVHGIIQKIFHHFNTIVKNIYIKIDMLKEK
ESLTLHYGDLTDASNLHSIVSKVNPTEIYNLGAQSHVKVSFDMSEYTGDVDGLGCLRLLD
AIRSCGMEKKVKYYQASTSELYGKVQEIPQSETTPFYPRSPYAVAKQYAYWIVVNYREAY
DMYACNGILFNHESPRRGPTFVTRKITRFVAGIACGRDEILYLGNINAKRDWGHARDYVE
AMWLMLQQEKPEDFVIATGETHSVREFVEKSFKEIDIIIKWRGEAEKEEGYCEKTGKVYV
KIDEKYYRPTEVDLLLGNPNKAKKLLQWQIKTSFGELVKEMVAKDIEYIKNGDKYN
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagtgaagaacgtaaagtagcattaattactggtattactggtcaagatggttcatat
ttaacagagttccttattagtaagggctattatgttcatggtattattcagaagatcttt
catcattttaataccattgtaaaaaacatttatatcaagatcgacatgttgaaggaaaaa
gaatcacttactttacattatggtgatttaacagatgctagtaatttacatagtattgtt
tcaaaagttaatccaactgaaatttataatttaggtgcacaaagtcatgttaaagtttca
tttgatatgtcagaatatacaggtgatgttgatggtttaggttgtcttcgtttattggat
gcaattcgtagttgtggtatggagaaaaaggttaaatattatcaagcttcaacctctgaa
ttatatggtaaagttcaagagattccacaatcagagaccacaccattctatccacgttca
ccatacgctgtcgcaaagcaatatgcctattggatcgttgtaaactatcgtgaggcttac
gatatgtatgcatgtaatggtatcttattcaatcatgaatcaccacgtagaggtccaact
tttgtaactagaaagatcactcgtttcgttgctggtattgcatgtggtagagatgaaatt
ctctacttgggtaatatcaacgctaaacgtgattggggtcacgctagagattacgttgaa
gcaatgtggttaatgttacaacaagagaagccagaagatttcgttattgccactggtgaa
actcattcagttcgtgaatttgttgaaaaatcattcaaagaaattgatatcatcatcaaa
tggagaggtgaagcagaaaaagaagaaggttactgtgaaaagactggtaaagtttacgtt
aaaattgatgagaaatattacagaccaactgaagttgatcttttacttggtaatccaaat
aaagcaaagaaattattacaatggcaaattaaaacttcttttggtgaactcgttaaagaa
atggttgctaaagatattgaatatattaaaaatggtgataaatataattaa

DBGET integrated database retrieval system