KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284735
Entry
DDB_G0284735      CDS       T00245                                 

Symbol
copB
Name
(RefSeq) adaptin N-terminal domain-containing protein
  KO
K17301  coatomer subunit beta
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0284735 (copB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0284735 (copB)
Membrane trafficking [BR:ddi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    DDB_G0284735 (copB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DDB_G0284735 (copB)
SSDB
Motif
Pfam: Adaptin_N Coatomer_b_Cpla Coatamer_beta_C Cnd1 HEAT_2 Coatomer_g_Cpla Nrap_D2
Other DBs
NCBI-GeneID: 8624744
NCBI-ProteinID: XP_638375
dictyBase: DDB_G0284735
UniProt: Q23924
Position
4
AA seq 912 aa
MSALTQSGSIEKPCTILINYDKGDPPQVNEFKQNFEHGTTEQKIETLKKVILYTINGEPI
PQLLMPIILYVMPSNDHTIKKLLLIYWEVIEKTHLGKLKSEMILVCNSLLNDLNHPNEFV
RGSTLRFLCKLREAEVLEPLVPSVRSNLENRHAYCRRNAVLAIYNIYSHFDYLIPDAPEL
IYNFLLQEKDASCKRNAFIMLFNCAPEKAVEYLSSVLDEVPSFGDMLQFIVVELIRKVCK
TSPSERSKYIKCIFTLLNSSSPAVKYESAGTLLSLSSAPTAVRGAASAYIDLLCNESDNN
VKMIVLDKLIEIKKNHSKIMEELVMDILRALSSPNIDICKKVLNIVLDSVTPKNIDEIIL
FLKKEINKTQSKEFDKGLEYRHILIRTIHVSSLKYPEVLGNVVPLLMEYLGDSYLPSAVD
VVIFLREVVETYPSLRELIIKKLIENLSSIKVSKVYRVAVWVIAEYVTCLEDLQYAMTSI
TNDLEELLKPKQTEEVILETKAKVKIEKVSIQKLIADGDWYLASCISSSLTKLFFRAEQL
NIDNADSNKLKAQVMMIISVLINLSKASQVSTSKSAYERMLSCIQVLIDSNATIKKIWLQ
DCRDSFANYLKYLLIKQSENKKKTEKEVLVKPNNIINIRQLKSKKAFGPVDTEDDLIKAV
GNTGEANKDQNEYSKISQLSGFSDPIYVEAYVRVHQYDIVLDISVFNQTNDTLQNVTLEL
VTLGDLKICERVPPFTMAPREKTSAKASIKVSSTDNGVIMGTIAFDIAGSVSSMSDKNCV
ILNELHIDVIDYILPANHQYTDVLFRNHWLEFEWENKIPVNTNITDLVKYVHHISKVTNM
GILTPEVHLSNDTGILSANLCAKSVFGEDALANICIEKQADGKISGYIRIRAKVQSIAVT
LGEKIGNMGMKA
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgtcagcattaacacaatcaggatcaatagagaaaccatgtacaattttaatcaactat
gataaaggtgatccaccacaagtcaatgaattcaaacaaaacttcgaacatggtacaact
gaacaaaagattgaaacattaaaaaaggttattctctatacaatcaatggtgaaccaatt
ccacaattacttatgccaatcattctttatgttatgccatcaaatgatcataccattaaa
aaactattactcatctattgggaagtaattgaaaaaactcatcttggtaaattaaaatcc
gaaatgattttagtatgtaattcattattaaatgatttaaatcatccaaatgaatttgta
cgtggtagtacattaagatttttatgtaaattaagagaagcagaagttttagaaccatta
gtcccatctgttcgttcaaaccttgagaatagacatgcatattgtagaagaaatgcagtt
ttagcaatctataatatctatagtcactttgattatttaattccagatgcaccagaatta
atttacaactttttattacaagaaaaagatgcatcatgtaaaagaaatgcatttattatg
ttatttaattgtgcaccagaaaaagctgttgaatatctttcatcagttttagatgaagta
ccatcatttggtgatatgcttcaatttattgttgttgaattaattagaaaagtttgtaaa
acttcaccatcagaaagatcaaaatatattaaatgtatttttacattattaaattcatca
tcaccagcagttaaatatgaaagtgcaggtacattattatcattatcatcagcaccaaca
gcagtacgtggagcagcaagtgcatatattgatttattatgtaatgaaagtgataacaat
gtaaagatgattgtattggataaacttattgaaatcaaaaagaatcatagtaagattatg
gaggagttggttatggatattttaagagcattatcaagtccaaacattgatatctgtaaa
aaggtattgaatattgttttagattcagtcacaccaaagaatatcgatgagatcattttg
tttttaaagaaagagatcaacaaaactcaatccaaagaatttgataaaggtttagagtat
cgtcatattttaattcgtaccattcatgtctcctcgttgaaatatccagaggtacttggt
aatgttgtaccattgttaatggagtatttgggtgatagttaccttccatcagccgttgat
gtagtcattttccttcgtgaagtcgttgaaacctatccaagtttaagagaattaatcata
aagaaactcattgaaaacctttcatccatcaaggtttcaaaggtttatcgtgtcgctgtt
tgggtgatcgctgaatatgtcacttgtcttgaggatcttcaatatgctatgacctcaatc
accaatgatctcgaggaattattaaaaccaaaacaaactgaagaggttattttggagaca
aaagcaaaggtaaagattgaaaaagtttcaattcaaaaattaattgcagatggtgattgg
tatttggcatcttgtatctcaagttctttaacgaaattattctttagagccgagcaattg
aatatcgataatgcagactccaataaattaaaggcacaagttatgatgatcatttccgta
ttaattaatcttagtaaggcaagtcaagtttcaacttcaaaatccgcctatgaaagaatg
ctctcatgtattcaagttttaatcgatagtaatgcaaccattaaaaagatttggcttcaa
gattgtcgtgactcttttgccaactatctcaaatatcttttaattaaacaaagtgaaaat
aaaaagaaaacagagaaagaggttttggttaaaccaaacaatatcatcaacattagacaa
cttaaatcaaagaaagcctttggtccagtcgatacagaggatgatttaattaaagcagtt
ggtaacactggtgaagccaataaagatcaaaatgaatactcaaagatctctcaattgtct
ggtttctctgatccaatttacgtcgaagcttacgttagagttcatcaatatgatatcgtt
ttggatatctctgtgttcaatcaaaccaatgatacccttcaaaacgttacattggaattg
gtcactttgggtgacttgaagatttgcgaacgtgtcccaccatttacaatggctccacgt
gaaaaaacttcagccaaagcttcaatcaaagtctcttcaactgataatggtgtaattatg
ggtacaattgctttcgatatcgctggttccgtcagtagtatgtctgataagaattgtgtc
atccttaatgaacttcatattgatgttatcgattatattcttccagctaatcatcaatac
actgatgttcttttcagaaatcattggctcgaatttgaatgggaaaataaaataccagtc
aatacaaatattaccgatttagttaaatacgttcatcacattagtaaagtcaccaacatg
ggtatcttaacaccagaagttcatctttcaaatgatactggtatcctctctgctaatctt
tgtgctaaaagtgttttcggtgaagacgcacttgctaatatttgtattgaaaaacaagct
gatggtaaaatttctggttatattagaattagagctaaagttcaatcaattgctgttaca
ttaggtgaaaagattggtaatatgggtatgaaagcttaa

DBGET integrated database retrieval system