KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284785
Entry
DDB_G0284785      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: XLF
Other DBs
NCBI-GeneID: 8624774
NCBI-ProteinID: XP_638404
dictyBase: DDB_G0284785
UniProt: Q54P54
Position
4
AA seq 531 aa
MHNKTLTNQILEELKEKEWKSFTIGNSLSGENSTLFIKSNFTHDTYSMIISDLSLVWIKH
SDSTTTLNDKNRFNPHLDSPTEKILSILRESIIEKKPDTAYRISINNSNNLVFTISNKIS
FYTFKWNFECEPIESIINSDSRKSHSDFIRDHLIMPLMFCCKNQQISNQLLTRKLDKIVN
IATSTSTSTSTSTSNISSTGSNININNGGVATLSVSIGTGGRNLKNNNNYKKGGIINIYQ
NILSENQKVEDFSENDFNFFNDPIFLQYYNHLYPDQNINNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNNDYDNNQTDLNSTVLEIDSNDLN
IKNSTKSIFNTYSSNIPISHTNSTTTTTTTSSSNGIITNEPLSLFYDVELTPKKNYNLNN
NSRNRTNNSTMTSLPSSISFIPFLNSQTTTSSLSSFANIHNDDNDNNNENDTTTNNNRNN
TSNNLKEQFEILQKQNSQELLEEKKRKLELEEKLEQSKQKQLNKKKKTKFV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcataacaaaacattgacaaatcaaatattagaagagctaaaagaaaaagaatggaaa
tcatttacgattggaaatagtttaagtggtgaaaattcaactttatttataaaatcaaat
tttacacatgatacctattcaatgattatatcggatttatcattagtttggattaaacat
tctgactctactacaactttaaatgataaaaatagatttaatccacatttagattcacca
actgaaaagattcttagtatattaagagaatcaataattgaaaaaaaacctgatactgca
tatagaatttcaataaataattcaaataatttagtattcacaatatcaaataagatatca
ttttatacatttaaatggaattttgaatgtgaaccaattgaaagtattataaattcagat
tcaagaaaatcacattcagattttattagagatcatttaattatgccattaatgttttgt
tgtaagaatcaacaaatttcaaaccaacttttaacaagaaaattagataaaattgtaaat
attgcaacatcaacatcaacctcaacttcaacatcaacatcaaatattagtagtactggt
agtaatataaatataaataatggtggtgttgctacattatcagtttctattggtactggt
ggaagaaatttaaaaaataataataattataaaaaaggtggaattattaatatatatcaa
aatatactttcagagaatcaaaaagttgaagatttctctgaaaatgattttaactttttt
aatgacccaatatttttacaatactataatcatttatatcctgatcaaaacataaataat
aataataataataataataataataataataataataataataataataataataataat
aataataataataataataataataataataataataataataataataataataataat
aataataataataataataataataataataataataataataccaataataatgattat
gataataatcaaactgatttaaattcaacagttttagaaattgattcaaatgatttaaat
attaaaaattcaacaaaaagtatttttaatacttattctagtaatatacctattagtcat
acaaattcaacaacaactacaacaactacttcatcttcaaatggtataataacaaatgaa
ccattatcactattttatgatgtagaattaacaccaaaaaagaattataatttaaataat
aatagtagaaatagaacaaataatagtacaatgacatcattaccatcatcaatatcattt
ataccatttttaaattctcaaactacaactagttcattatcatcatttgcaaatattcat
aatgatgataatgataataataatgaaaatgataccaccaccaacaacaacagaaataat
acatcaaataatttaaaagaacaatttgaaattttacaaaaacaaaattcacaagaatta
cttgaagaaaagaaaagaaaattagaattggaagaaaaacttgaacaatcaaaacaaaaa
caattaaataaaaaaaagaagacaaaatttgtttaa

DBGET integrated database retrieval system