KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285339Help
Entry
DDB_G0285339      CDS       T00245                                 

Gene name
mipp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00562  Inositol phosphate metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0285339 (mipp1)
   00562 Inositol phosphate metabolism
    DDB_G0285339 (mipp1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     DDB_G0285339 (mipp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     DDB_G0285339 (mipp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 MID_MedPIWI Lectin_C
Motif
Other DBs
NCBI-GeneID: 8625053
NCBI-ProteinID: XP_638245
dictyBase: DDB_G0285339
UniProt: Q54ND5
Position
4
AA seq 635 aa AA seqDB search
MMVKIKNIIILFCIFGLLSNVSSLSSSSSSSQSSDNNGNLSPIQDYDLEFLSKHLTTKTP
YWILTKNGDSNSQGDGSSGNSNSNSNSNSNSNSNSDSSNEPPEQCKLISIDFIARHGSRM
PVLNSIEKLKEMTTSILEYKEQVNQGFNWIFNYSVPYPSDIAGNLILQGQYEHYNISKRL
LKKYPLFFEPMKYKPQSYSITSTAISRTGISASAFSYGLLQGTGSLGVDGFQPVFIETAS
LDQDILLRFFATCNQYVDQLKNGTLINKDEQTKWNQMVFPNISNEISERLGLSDIWLPTS
NVISDIFEACAYEISINNISDHWCSLLSKQNILDWEYSQDLSNYWLKSYGHEINYQIATP
LLNDILSGFDIYINNNNNGSSSSSSSSSSNNGDNSGSNGSSGSGSSTSTSSNDNGSTNNN
DNKVEPTSILRFGHAETIIPFISLLGLYKDEQKLFANSSTEQIENRKFRTSVVSPYASNI
AMFLFDCGSAADGFKILVQHNELPVLVPGCDEIYCDYQQFKSIFKQGIDNFKWNSYCNIN
DDDSGSSGGDSGNGNGNDSHSKKSSYFLAIFIPITFLVGGTIGGIFTYFSYEKIMQVKNR
KKLTQYGNDEFISSPKSKSFSFKPTKFDSRSPLIQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatggtaaaaattaaaaatattataatattattttgtatttttggactattatcaaat
gtttcatcattgtcatcgtcatcatcatcatcacaatccagtgataacaatggtaattta
agtccaattcaagattatgatcttgaatttcttagtaaacatttaacaacaaaaacacca
tattggattttaactaaaaatggtgactcaaatagtcaaggagatggtagtagtggtaat
agtaatagtaatagtaatagtaatagtaatagtaatagtaatagtgatagtagtaatgaa
ccaccagaacaatgtaaattaatatcaatagattttatagcacgtcatggatcgagaatg
ccagttttaaattcaattgaaaaattaaaagaaatgacaacaagtatattagaatataaa
gaacaagttaatcaagggtttaattggatatttaattatagtgtaccctatccaagtgat
attgctggtaatttaatattacaaggtcaatatgaacattacaatatctcaaaacgtcta
ttgaaaaagtatccactattctttgaaccaatgaaatacaaaccacaatcctattcaatt
acatccactgccatatcacgtactggtattagtgcaagtgcattctcctatggtttatta
caaggtactggttcattgggagtggatggatttcaaccagttttcatcgaaaccgctagt
ttagaccaagatatcctattaagattctttgcaacttgtaatcaatatgtagatcaactt
aaaaacggtacattaattaataaggatgaacaaactaaatggaatcaaatggtatttcca
aatatatcgaatgaaatctctgaacgtttagggttatccgatatttggttaccaactagt
aatgtcatctctgatatattcgaagcttgtgcctatgaaatatcaatcaataacattagt
gatcattggtgttcacttctaagtaaacaaaatatcttggattgggaatattctcaagat
ttaagtaattattggttaaaaagttatggtcatgaaattaattatcaaattgctacacca
cttttaaatgatattttatctggttttgatatttatattaataataataataatggtagt
agtagtagtagtagtagtagtagtagtaataatggtgataatagtggtagtaatggaagt
agtggtagtggtagtagtacatcgacctcatcaaatgataatggtagtaccaataataat
gataataaggtagaacctacatcaattttaagatttggacatgctgaaactattattccc
tttattagtttacttggattatataaggatgaacaaaagttatttgcaaattcaagcact
gaacaaattgaaaatagaaagtttagaacttctgttgtttctccatatgcttcaaatatt
gctatgtttttatttgattgtggtagtgctgctgatggttttaaaatattggttcaacat
aacgaattaccagtattggtaccaggttgtgatgaaatctattgtgattatcaacaattt
aaatcaatttttaaacaaggtattgataattttaaatggaattcatattgtaatattaat
gatgacgatagtggtagtagtggtggtgatagtggtaatggtaatggtaatgattctcat
tcaaagaaatcatcttactttttggcaatattcattccaattacatttttagttggtgga
acaattggtggaatttttacctatttctcttatgagaaaataatgcaagttaaaaataga
aagaaacttactcaatatggaaatgatgaatttatttcttctccaaaatcaaaatccttt
tcatttaaaccaactaaattcgattcaagatctccattgatccaataa

DBGET integrated database retrieval system