KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285601Help
Entry
DDB_G0285601      CDS       T00245                                 

Gene name
cdc20
Definition
(RefSeq) WD40 repeat-containing protein
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04120  Ubiquitin mediated proteolysis
Module
ddi_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DDB_G0285601 (cdc20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0285601 (cdc20)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0285601 (cdc20)
Ubiquitin system [BR:ddi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     DDB_G0285601 (cdc20)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    DDB_G0285601 (cdc20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 IKI3
Motif
Other DBs
NCBI-GeneID: 8625198
NCBI-ProteinID: XP_638150
dictyBase: DDB_G0285601
UniProt: Q54MZ3
Position
4
AA seq 499 aa AA seqDB search
MNSNYETAELEQLLSLNAPLENVEARWQRKARQNNSNTNNNNGNNGGDRFIPNKMNIDIG
HFNLTKENSNPNPNAINNNSSTSTSTTATSSTTNNIESTLYKDTLANQLFESNSGDLESK
ILSFKSKAPVGNVSSSTNSLRVLYSQNQVGSTPTDQSLKKQFRQIPQQPERILDAPDIVD
DYYLNLLDWSSQNVIAIPLGQTVYLWNATTSEIQRLFQVEQQDDYITSLQWTKDGNYLAV
GTNSCTIQLWDVAHTKKVRELRGHAGRVGALAWNDYILSSGSSDTNIFNHDVRVQNHHVS
TLSGHSQEVCGLKWSHDGGQLASGGNDNIINIWDINSENFETPAHTFEQHTAAVRALAWC
PFQPNLLATGGGAADRTIRFWNTITGVCLNTVDTMSQVCSIQWSTTYRELVSSHGYSQNQ
LCVWKYPSMVKCAELTGHTSRALHTAISPDGETVVSASADETLRFWRVFEKENKLPTANR
KSKEVSDGSMMRNINSLIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaattatgaaacagcagaattagaacaattattaagtttaaatgcaccatta
gaaaatgttgaagcaagatggcaaagaaaagcaagacaaaataatagtaatacaaacaat
aataatggtaataatggtggtgatagatttataccaaataaaatgaatatagatattgga
cattttaatcttactaaagaaaattcaaacccaaatccaaatgcaataaataataattca
tcaacatcaacatcaacaacagcaacatcgtcaacaactaataatatagaatcaacactt
tataaagatacattagcaaatcaattatttgagagtaatagtggtgatttagaatcaaag
attctttcatttaaatcaaaagcacccgttggtaatgtatcatcatcaaccaattcatta
cgtgtactctatagtcaaaatcaagttggtagtacaccaaccgaccaatcattaaagaaa
caatttcgtcaaataccacaacaaccagaacgtatattggatgcaccagatattgtcgat
gattattatttgaatctactcgattggagtagtcaaaatgtaattgcaattccattgggt
caaacggtttacctttggaatgcaaccactagtgaaattcaaagattgtttcaagtggag
caacaagacgattatattacatcacttcaatggacaaaagatggtaactatttagccgtt
ggtaccaatagttgtaccattcaattatgggatgtcgctcataccaagaaggtacgtgaa
cttcgtggtcacgcgggtagagttggtgctttggcatggaatgattatattttaagttca
ggttcatccgataccaatatcttcaatcatgatgtacgtgtacaaaatcatcatgtctca
acattgtcaggtcattctcaagaggtttgtggtcttaaatggtcacatgatggtggccaa
ttggcttcgggtggcaatgataatatcatcaacatttgggatatcaattctgagaacttt
gaaacaccagctcatacatttgaacaacatactgctgccgttcgtgcattggcttggtgt
ccttttcaaccaaatttactcgctacaggtggtggtgctgccgatcgtaccattcgtttt
tggaatacaattactggtgtttgcttaaatactgtcgatacaatgtcacaggtttgttct
attcaatggtcaactacctatcgtgaattggtttcaagtcatggttactctcaaaatcaa
ctttgtgtttggaaatatccctcaatggtaaaatgtgctgaactcactggtcatacttca
agagctttacacactgcaatatcacccgatggtgaaactgtagtttctgcttctgccgat
gaaactcttcgtttttggagagtatttgaaaaagaaaataaacttccaactgctaatcgt
aaatcaaaagaagtttctgatggttcaatgatgagaaatataaattctttaattcgttaa

DBGET integrated database retrieval system