KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286169
Entry
DDB_G0286169      CDS       T00245                                 

Gene name
rabZ
Definition
(RefSeq) Rab GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 FeoB_N SRPRB AAA_15 RsgA_GTPase G-alpha TniB AAA_16 E1_dh AAA_24 Ribosomal_L7Ae AAA_22
Other DBs
NCBI-GeneID: 8625453
NCBI-ProteinID: XP_001134534
dictyBase: DDB_G0286169
UniProt: Q1ZXE7
Position
4
AA seq 229 aa
MGCFHSREPTATGKTKKEEPTSAVKTNKEEKSSNYVSEPTTMEKIKKDDVYTIILIGDQA
TGKSSVLQRFKNNQFEVCHKPSPIIIDCFTKKIQIEGKKISLKCYDTAGQEKFRALSQSY
YRCADGIMLFYDIANQKTFDNVGRWLEEVHRLAGPNVPILIIANKCDLNEKRVVNFNNAK
KFADDKNIPIIEVSAKESLGVEEAFIKLASEINKTWKPLPDNETVTIGM
NT seq 690 nt   +upstreamnt  +downstreamnt
atgggttgttttcactcaagagaaccaactgcaactggaaaaacaaagaaagaagaacca
acttcagccgtaaaaacaaataaagaagaaaagtcttctaattatgtatcagaaccaacc
acaatggaaaaaataaagaaagatgatgtatatactattatattaattggtgatcaagca
acaggtaaatcttcagtattacaaagatttaaaaataatcaatttgaagtttgtcataaa
ccatcacctataataattgattgttttacaaaaaaaattcaaatagaaggtaaaaaaata
agcctcaaatgttacgacactgcaggccaagaaaaattcagggcactttctcagtcctat
tatagatgtgctgatggtattatgcttttttatgatatcgcaaatcaaaaaacatttgat
aatgtaggtagatggttggaagaagtgcataggttagcaggtccaaatgttccaatttta
attattgcaaataaatgcgaccttaatgaaaaaagagttgtgaattttaataatgcaaaa
aaatttgcagatgataaaaacattccaattattgaggttagtgcaaaggaatctttgggt
gtcgaagaagcatttataaaattagcatctgaaataaataaaacatggaaaccactacca
gataatgaaactgtaacaattggaatgtaa

DBGET integrated database retrieval system