KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286189Help
Entry
DDB_G0286189      CDS       T00245                                 

Gene name
sumo
Definition
(RefSeq) hypothetical protein
  KO
K12160  small ubiquitin-related modifier
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    DDB_G0286189 (sumo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0286189 (sumo)
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0286189 (sumo)
   03029 Mitochondrial biogenesis [BR:ddi03029]
    DDB_G0286189 (sumo)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ddi04812]
    DDB_G0286189 (sumo)
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     DDB_G0286189 (sumo)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   DDB_G0286189 (sumo)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    DDB_G0286189 (sumo)
Cytoskeleton proteins [BR:ddi04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    DDB_G0286189 (sumo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 8625509
NCBI-ProteinID: XP_637795
dictyBase: DDB_G0286189
UniProt: Q8N0B4
Position
4
AA seq 98 aa AA seqDB search
MENTKEEPGVNGEAPVKDEHINLKVKNQGGGEVFFKIKRSTPLKKLMEAYCQRQGLNYAS
CRFLFDGVRVKEDATPNQLGMENEDVLDCALMQTGGSF
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataccaaagaagaaccaggagttaacggtgaagctccagtaaaggatgaacac
atcaatcttaaagttaaaaaccaaggcggtggtgaagtatttttcaaaatcaagagatca
acacctttaaagaaattaatggaagcatattgtcaaagacaaggtcttaactatgcaagt
tgtcgtttcttatttgatggtgttcgtgtcaaagaagacgccacaccaaatcaattaggt
atggagaatgaagatgttttagattgtgcattaatgcaaactggtggttctttctaa

DBGET integrated database retrieval system