KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286353
Entry
DDB_G0286353      CDS       T00245                                 

Gene name
erkA
Definition
(RefSeq) ERK subfamily protein kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0286353 (erkA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0286353 (erkA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0286353 (erkA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DDB_G0286353 (erkA)
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   DDB_G0286353 (erkA)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DDB_G0286353 (erkA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0286353 (erkA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Spore_coat_CotO Ndc1_Nup DDHD PepSY_TM Zip RR_TM4-6 Exonuc_VII_L Mem_trans APH DUF4228 GREB1
Other DBs
NCBI-GeneID: 8625569
NCBI-ProteinID: XP_637704
dictyBase: DDB_G0286353
UniProt: P42525
Position
4
AA seq 529 aa
MEPEFDHFQSQMDSDNTHQSTMFNVQDNNAILMSGMENVLQSPRQLQAAAQAQQQAAAQA
QQQQVQAQQVQAQQAQQQQQQQQNQQQQQQQQNQQNQQQQQNQQQQSQQMTQQQLQQLMP
PPPTSDTSNFNDNISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSAKDNLTGEKVAIKKI
SKAFDNLKDTKRTLREIHLLRHFKHENLISIKDILKPNSKEQFEDVYIVSELMDTDLHQI
ITSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLARVE
DATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDYIHQ
ITLIIETIGSPSEEDICNIANEQARQFIRNMGNQPKVNFANMFPKANPDAIDLLERMLYF
DPSKRLTVEEALAHPYFQSLHDPSDEPICLHKFSLNFEAWDLNRDLLKELIYNEMLAYHP
EDPQAPYYTDLNNPNFNLSRIQSSSELFNLLQQQKQQIHQQVNQQSIKN
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggaaccagaatttgatcactttcaatcacaaatggattccgataatacacaccaatca
acaatgtttaatgtccaagataataatgccattctaatgagtggaatggaaaatgttctc
caatctccacgtcaattacaagcagctgcacaagcacaacaacaagcagctgcacaagct
caacaacaacaagtacaagctcaacaagtacaagctcaacaagcacaacaacaacaacaa
caacaacaaaaccaacaacaacaacaacaacaacaaaaccaacaaaaccaacaacaacaa
caaaatcaacaacaacaatcacaacaaatgacacaacaacaattacaacaattaatgcca
ccaccaccaacaagtgatacaagtaattttaatgataatatatcatattttgtatatgga
tcacaatttacagtaccaagaagatattcaatagtaaagtgtataggacatggtgcctat
ggagttgtttgttctgccaaagataatttaacaggagaaaaggttgcaattaaaaagatt
agtaaagcatttgacaatttaaaagatacaaaacgtacattacgtgaaattcatttactt
agacattttaaacatgaaaatcttatctcgatcaaggatatattgaaaccaaatagtaaa
gagcaatttgaagacgtttatatagtttcagaattgatggatacagatttacaccaaatt
ataacttcaccacaaccattatcggatgatcattgtcaatatttcgtttatcaaatgtta
cgtggtctaaaacatattcattcagcaaatgtattacatagagatttaaaaccttcaaac
cttttaataaatgaagattgtctattaaaaatttgtgatcttggtcttgctcgtgttgaa
gatgcaactcatcaaggttttatgactgaatacgttgcaactcgttggtatcgtgctcct
gaagtcattctatcttggaataaatatacaaaagcaattgatatttggtctgtaggttgt
attttcgctgaacttttaggtagaaaacctttattccaaggaaaagattatattcatcaa
attacattaattatagaaactattggatcaccatcagaagaagatatttgtaatattgca
aatgaacaagcacgtcaatttataagaaatatgggtaaccaaccaaaagttaattttgca
aatatgttcccaaaagcaaatccagatgcaattgatttattagaaagaatgttatatttt
gatccaagtaagagattaacggttgaggaagctttggcacatccatattttcaatcttta
catgacccatcagatgaaccaatttgtttacataagtttagtttaaattttgaagcatgg
gatttaaatagagatttattaaaagaattaatttataatgaaatgttagcttatcatcct
gaagatccacaggcaccatactatactgacttaaataatcctaatttcaatttatcaaga
attcaatcttcaagtgaattatttaatttattacaacaacaaaaacaacaaatacatcaa
caagtaaatcaacaatcaattaaaaattaa

DBGET integrated database retrieval system