KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286557Help
Entry
DDB_G0286557      CDS       T00245                                 

Gene name
pten
Definition
(RefSeq) 3-phosphatidylinositol 3-phosphatase
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00562  Inositol phosphate metabolism
ddi01100  Metabolic pathways
ddi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DDB_G0286557 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    DDB_G0286557 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ddi01009]
    DDB_G0286557 (pten)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DDB_G0286557 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     DDB_G0286557 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     DDB_G0286557 (pten)
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    DDB_G0286557 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc PTPlike_phytase Y_phosphatase3 Y_phosphatase CDKN3 DUF1421
Motif
Other DBs
NCBI-GeneID: 8625716
NCBI-ProteinID: XP_637576
dictyBase: DDB_G0286557
UniProt: Q8T9S7
Position
4
AA seq 533 aa AA seqDB search
MSNLLRVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEKVEGVFRNPMKDVQRFLDQY
HKDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSKNIA
VIHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGYFGR
SIRESIKYVPRNVTLKKIVLRPLPKEINLSEVQFNISVGKNCVFNSKEHNMNVVISKKKK
TVVDKNKKDPKKKLTKENSEKNIDSQQQQQSQSSLSQSQQGQSSPNMQSLSASGTISSGS
NVGTVNGNTLHQLGGSQFSLSDLADGNTIGNDEYISFEIGALSLAGDIRIEFTNKQDDRM
FMFWVNTSFVQQLEIIPKSGLDKAHKDKNHKAFPEDFHVELTFDQLDQQQSHTTVVASAE
EQTNNQHYPQSSNNVATSSSHHDNITVVASDAPQNNNNNNNLNSSNSNNATTTTTKNNIS
LASSQSNPVQQESNPSTTTQVSEENSAPKVEAEKIENSNASANDSETSSNSSS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttattaagagttgcagtctctaaacaaaagagaagatatcaaaaaaatggt
tacgatttagatttagcatatattactgataatattgttgcaatgggatttccaagtgaa
aaagttgaaggtgtttttagaaatccaatgaaagatgtacaaagatttttagatcaatat
cataaagatcatttcaaagtatataatttatgttcagaacgtgtttatgaccattcaaag
ttttatggtcgtgttggatattacccattcgatgatcataatgcaccacaatttgaaatg
atcgatgcattttgtagggatgtagatgcatggatgaaggaggattcaaagaacattgca
gtaattcattgtaaagcaggtaaaggtcgtacaggtcttatgatttgttgttggttaatg
tattgtggtatgtggaagaatacagaggattccttaagattttatgcagcattacgtaca
tacaatcaaaagggtgttacaattccatctcaaattagatatgtaggttactttggcaga
tccattagagagtcaatcaaatatgtaccacgtaatgtcactctaaagaaaattgtatta
agaccattaccaaaagaaattaatttatcagaagttcaattcaatatatccgttggtaag
aattgtgtattcaatagtaaagaacataatatgaacgttgtaatctcaaagaaaaagaaa
acagttgtagataaaaataaaaaggatccaaagaaaaaattaacaaaagaaaatagtgaa
aaaaatatagatagtcaacaacaacaacaatcacaatcatcactttcacaatcacaacaa
ggacaatcatcaccaaatatgcaatcattaagtgctagtggtacaattagtagtggtagt
aatgttggtacagttaatggtaatacacttcatcaattaggtggaagtcaatttagttta
agtgatttagctgatggtaatacaattggtaatgatgaatatatctcctttgagattgga
gctttgtcattggctggtgatattagaatcgaatttacaaacaaacaagatgatcgtatg
tttatgttttgggtaaacacttcattcgtacaacaactcgaaattattccaaagagtggt
ctcgataaagcacacaaagataagaaccataaagctttcccagaggatttccatgtcgaa
ttaacatttgatcaacttgatcaacaacaatcccatacaaccgttgttgcttctgctgaa
gaacaaacaaacaatcaacattatccacaatcctcaaataatgtagcaacatcttcctct
catcacgataatattacagttgtagcatcagacgcaccacaaaataataataacaataat
aatttaaatagtagtaatagtaataacgccacaactaccaccaccaaaaataatatatct
ttagcatcatctcaatcaaaccctgtacaacaagaatcaaacccatcaacaactacacaa
gtatcagaagaaaattcagctccaaaggttgaagcagaaaaaattgaaaatagtaatgca
agcgcaaatgacagtgaaacttcttcaaatagctcaagttaa

DBGET integrated database retrieval system