KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286907
Entry
DDB_G0286907      CDS       T00245                                 

Gene name
ubqD
Definition
(RefSeq) hypothetical protein
  KO
K08770  ubiquitin C
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DDB_G0286907 (ubqD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0286907 (ubqD)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   DDB_G0286907 (ubqD)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 DUF2407 Methyltrans_RNA
Other DBs
NCBI-GeneID: 8625864
NCBI-ProteinID: XP_637465
dictyBase: DDB_G0286907
UniProt: P0CG77
Position
4
AA seq 229 aa
MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcaaatctttgttaaaactctcactggtaagactatcactttagaagttgaaggttct
gataatattgaaaatgtaaaggctaaaatccaagataaagaaggtattccaccagatcaa
caacgtctcatttttgctggtaaacaattagaagatggtcgtactctctctgattacaat
attcaaaaggaatcaactcttcacttagttttaagattaagaggtggtatgcaaatcttt
gttaaaactctcactggtaaaactatcactttagaagttgaaggttctgataatattgaa
aatgtaaaggctaaaattcaagataaagaaggtattccaccagatcaacaaagattaatc
tttgccggtaaacaattagaagatggtcgtactctttctgattataacattcaaaaggag
tccactctccatttagttcttagattaagaggtggtatgcaaatctttgttaaaactctc
actggtaaaactatcaccttggaggttgaaggatctgataatattgaaaatgttaaagcc
aaaattcaagataaagaaggtattccaccagatcaacaacgtctcatttttgctggtaaa
caattagaagatggtcgtactctctctgattacaatattcaaaaagaatcaactctccac
ttagttttaagattaagaggtggtctttaa

DBGET integrated database retrieval system