KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286993Help
Entry
DDB_G0286993      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00562  Inositol phosphate metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0286993
   00562 Inositol phosphate metabolism
    DDB_G0286993
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     DDB_G0286993
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     DDB_G0286993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8625895
NCBI-ProteinID: XP_637449
dictyBase: DDB_G0286993
UniProt: Q54L08
Position
4
AA seq 507 aa AA seqDB search
MKIIFLIIFIYLLINFNLIWCQIEKNNLKVFNQIKINNDIFQKQKEITFGEYQNYDFNFL
IKHLTTKTPYYKSNHFIKKDENNNNNFKQQQQQCKLISIDFIGRHGSRMPEASVIKKMKK
LQNEILKINKYIENDGEFGWLKNYTVPYKIEIAGNLLTQGQLEHYHLSKRFLKRFPNYFG
NYKPQTTKISSTIISRTGVSASSFAYGLFEGTGVLGDNFQPVHIETSTLDKDILLSFFLN
CDKYNNALRDQSINDNEREIWKQMKYPSIGIEIKKRLGIPNSNLNDWELSNSIINTIFLS
CVYDVAIGNITNHWCSLLNKQNILDLEYSKDLDDYWLSSYGNKINYEISSPLLKDIFNHF
DSIINLNNNSNNNSNSDNDNKDEENNDEFSIDNNKYPKNILRFAHSETVIPLMSLLGLFK
DEYHLFANLTSNQIINRNFKTSVIVPYSTNLVMFLYDCGGENDFKILVEHNESPILIPGC
NDIFCNYQLFKSLFSNVINFNWDNYCS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatttttttaataatatttatttatttattaataaattttaatttaatatgg
tgccaaattgaaaaaaataatttaaaagtttttaatcaaattaaaattaataatgatatt
ttccaaaaacaaaaagaaataacatttggagaatatcaaaattatgattttaatttttta
attaaacatttaacaactaaaacaccatattataaatcaaatcattttataaaaaaagat
gaaaataataataataattttaaacaacaacaacaacaatgtaaattaatttcaattgat
tttattggtcgtcatggttcaagaatgccagaagcatctgttattaaaaaaatgaaaaaa
ttacaaaatgaaattttaaaaattaataaatacattgaaaatgatggagaatttggttgg
ttaaaaaattacactgttccttataaaattgaaatcgcaggaaatttattaactcaaggc
caattggaacattaccatctctcaaaaagatttttaaaaagatttccaaattattttgga
aattataaaccacaaactacaaagatttcatcaactattatttctcgtactggagttagt
gcttcatctttcgcctatggattatttgaaggaactggagttttgggtgataattttcaa
ccggttcatattgaaacttcaacacttgataaagatattttactaagtttctttttaaat
tgtgataaatataacaatgctttacgagatcaatcaattaatgacaatgaaagagaaatt
tggaaacaaatgaaatatccatcaattggaattgaaattaaaaaaagattaggtatacca
aattcaaatctcaatgattgggaactttcaaattcaataattaatacaatatttttatca
tgtgtttatgatgttgccattggaaatattacaaatcattggtgtagtctattaaataaa
caaaatattttggatttagaatattcaaaagatttggatgattattggttaagtagttat
ggtaataaaattaattatgaaatttcttcaccattattaaaagatatttttaatcatttt
gattcaataattaatttaaataataatagtaataataatagtaatagtgataatgataat
aaagatgaagaaaataatgatgaattttcaattgataataataaatatccaaaaaatata
ttaagatttgctcattcagaaactgtaataccattaatgtctttattgggtttatttaaa
gatgaataccatttatttgcaaatttaacttcaaatcaaattattaatagaaattttaaa
acaagtgttatagttccttactctacaaatttagtaatgtttttatatgattgtggtgga
gaaaatgattttaaaattttggttgaacacaatgaatcaccaattttaataccaggctgt
aatgatatcttttgtaattatcaactttttaaatctctcttttcaaatgttattaatttt
aattgggataattattgttcttaa

DBGET integrated database retrieval system