KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287033Help
Entry
DDB_G0287033      CDS       T00245                                 

Gene name
nagA
Definition
(RefSeq) glycoside hydrolase family 20 protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00511  Other glycan degradation
ddi00513  Various types of N-glycan biosynthesis
ddi00520  Amino sugar and nucleotide sugar metabolism
ddi00531  Glycosaminoglycan degradation
ddi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ddi00604  Glycosphingolipid biosynthesis - ganglio series
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DDB_G0287033 (nagA)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    DDB_G0287033 (nagA)
   00531 Glycosaminoglycan degradation
    DDB_G0287033 (nagA)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    DDB_G0287033 (nagA)
   00604 Glycosphingolipid biosynthesis - ganglio series
    DDB_G0287033 (nagA)
   00511 Other glycan degradation
    DDB_G0287033 (nagA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0287033 (nagA)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DDB_G0287033 (nagA)
Chaperones and folding catalysts [BR:ddi03110]
 Intramolecular chaperones
  Others
   DDB_G0287033 (nagA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b DUF3430
Motif
Other DBs
NCBI-GeneID: 8625929
NCBI-ProteinID: XP_637398
dictyBase: DDB_G0287033
UniProt: P13723
Position
4
AA seq 532 aa AA seqDB search
MIKKIILFFAVLIAIVIGQQPLNVVPYPQQVSIGTCVIPVAPGSILIESNIESATFSVSM
DRYTNLFFPFSNESEPSSNESFLLSVTIYSDDETLQLGIDESYSLSIEQGSYQLKATNIY
GAMRGLETFKQLIVYNELENSYSIVCVSISDSPRYPWRGFMVDSARHYIPKNMILHMIDS
LGFSKFNTLHWHMVDAVAFPVESTTYPDLTKGAFSPSATFSHDDIQEVVAYAKTYGIRVI
PEFDIPGHAAAWGIGYPELVATCPDYAANVNNIPLDISNPATFTFIQNLFTEIAPLFIDN
YFHTGGDELVTGCWLEDPAIANWMTKMGFSTTDAFQYFENNLDVTMKSINRTKITWNDPI
DYGVQLNPETLVQVWSSGSDLQGIVNSGYKALVSFAWYLDKQNPDNNIHYEWQDTWQDFY
AADPTNNISTNAENIIGGEATMWAEQINQVNWDVRVWPRAIGIAERLWSAQSVNSVSLAL
PRIGHFTCDLSRRGIQSGPLFPDYCPMQDDLVFTMKPNTKLSKSEIKLILNK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagattatattattttttgcagttttaattgcaattgtaattggtcaacaa
ccattgaatgttgtaccatatcctcaacaagtttctattggtacttgtgtcatcccagtt
gcaccaggatcaattcttattgaatcaaatattgaatcagcaacatttagtgtttcaatg
gatagatataccaatttattcttcccatttagtaatgaaagtgagccatcatcaaatgaa
agttttttactttcagttacaatctatagtgatgatgaaactcttcaattaggaattgat
gaaagttattcattaagcattgaacaaggttcctaccaattgaaagcaaccaacatctat
ggtgcaatgagaggtttggaaactttcaaacaattgatcgtctataatgaattggaaaat
agttattcaattgtatgcgtatcaattagtgattcaccaagatatccatggagaggtttc
atggttgattcggcccgtcattacatcccaaagaatatgatacttcatatgatcgattca
ttagggttcagtaaattcaatacattacattggcatatggttgatgctgttgcattccca
gttgaatcaaccacttatccagatttaaccaaaggtgctttctctccaagtgcaactttc
tctcatgacgatattcaagaggttgtagcatatgctaaaacctatggtattcgtgtaatt
cctgaattcgatataccaggccatgctgctgcttggggaattggttatccagaattggtt
gcaacttgtccagattatgctgcaaatgttaacaatattccattagatatttcaaatcca
gctacctttacattcattcaaaatcttttcactgaaattgcaccattattcattgataat
tatttccatactggtggtgatgaattagttactggttgttggcttgaagatccagcaatt
gcaaattggatgacaaaaatgggtttctcaactactgatgctttccaatattttgaaaat
aatttggatgttactatgaaatcaattaatcgtactaaaattacatggaatgatccaatt
gattatggtgttcaattaaatccagaaacattagttcaagtttggagtagtggttcagat
ttacaaggaattgtaaatagtggttataaagcacttgtatcatttgcatggtatttagat
aaacaaaatccagataataacattcattatgaatggcaagatacttggcaagatttttat
gctgctgatccaacaaataatatctctacaaacgctgaaaatattattggtggtgaagca
acaatgtgggctgaacaaattaatcaagtaaattgggatgttagagtttggccaagagca
atcggtatcgctgaaagattatggtctgctcaaagtgttaactctgtctctttagcactc
ccacgtattggtcattttacttgtgatctctcacgtcgtggtattcaatctggtccatta
ttcccagactattgtccaatgcaagatgatttggttttcactatgaaaccaaatactaaa
ctttcaaaatctgaaattaaattaattttaaataaataa

DBGET integrated database retrieval system