KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287193
Entry
DDB_G0287193      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Other DBs
NCBI-GeneID: 8625980
NCBI-ProteinID: XP_637358
dictyBase: DDB_G0287193
UniProt: Q54KS2
Position
4
AA seq 1058 aa
MINNKILIAILILILLIKLSNSLCIPILGGICILEGPLLLDVSQLFSSLDLKSNPLSILG
SIITITGKLTCDSTISLLGGTLVLQGLIEIKAGCVFKIGNETVIETSSSLLSMPLLSVEF
LNSNGNSSLTFKSSNSNSALDLQFFSLNGTETPKFIFNSNNVSISTSFLHLPISRIGKAI
VNMGNKIGSKLEISNDFKFDSLLIQNSISQLLLPDQIDISTLTLTNVNNVLGLSNLSPTI
TNLYTQLNLILDSTNISFNKKVFLKSINSISSNLNFLNSNIIIGVNNGNIINSMIQFNGN
ENNQILDLFGNLNLVSTISPIINSIQQLVTSSTNNNNNGIIRLNNGLINSNLIIGNDSSL
IYKLNCQLIGGTIGGTINSIGGLFLPNQLNLLEKLNLNLKSLLIDSGQILLNNSILNIKD
SIGFNNNVIGTMNLTNSLLELGGNIFNNTSNSFKDLLLINVKLSANNLILNIANNIILPN
RISLGIGSTLHFVNGIENDLKFQTTLDLNLLNSILNTNFVFVISTSSLIFCNGQSPPTMI
QLHGSSTSTYQFMCDNNMIVMRLTNCFGGYICPSNDQCVSNESQCSSIDDQSAVLPACNV
NEIRCLSGCHSNIDYCNNTQCISEGGTIECLSPTTAKSLKYNGCPFNYFQCGDGSCHLNK
LDCCVVGINCTQSLLVSTFVKPELSYSPIHTLKDMKVPIISKSKSTGILDIYGYVSMPSG
FLTINSLSKLKITYKDDSYLDSVNGDEIWGIDSNISQYRQSAISMIFDISIDTIPNPIFN
HNITFELKVNNLQLLNLSNYCLYYINTTQNKWNCETSSTISISPRNTLLVTTPHFTDFGV
LLNNYKPQTTRPPAGGGTWTNPTFTTTGTTTGTTTATTTATTTATTTATTTATGSSNPTT
TTTTNQQTTTTTISQTTNGGDGSSIDTTTGGSSNPTTTGTTTATTSGTTTATTTATTTAT
TTATTTATTTATTTATTTATTTATTGVTLTEEPISDEEDSNKNTIIMSTTISGGALVIAG
VSSYFINKRIRHGRVVYWWKLRKPPPSQLELSTTTTKV
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgataaataataaaattttaatagcaatattaattttaatattattaattaaattatca
aattcattatgtataccaatattaggtggtatatgtattttggaaggaccattattactt
gatgttagtcaattattttcaagtcttgatttaaaaagtaatccattatcaattcttgga
tcaataataacgataactggtaaattaacatgtgattcaactatatcattattaggtggt
acattagtattacaaggtttaattgaaattaaagctggatgtgtatttaaaattggcaat
gaaactgtaattgaaacttcatcatcactattgtcaatgccattgttatcagttgaattt
ttaaattcaaatggtaattcatcattaacatttaaaagttcaaatagtaattcagcattg
gatttacaattcttttcattaaatggtacagaaacaccaaaatttatatttaattcaaat
aatgtttcaatttcaacatcgtttttacatttaccaatttcaagaattggtaaagctata
gttaatatgggtaataaaattggtagtaaattagagattagtaatgattttaaatttgat
agtttattaatacaaaattcaatctcacaattattattacccgatcaaatcgatattagt
acattaacattaacaaatgttaacaatgtattaggtttatcaaatttatcaccaacaatt
acaaatttatatactcaattaaatttaatacttgattcaacaaatatatcatttaataaa
aaagtttttttaaagtcaataaattcaatttcaagtaatttaaattttttaaattcaaat
attataattggtgttaataatggtaatataataaattcaatgattcaatttaatggtaat
gaaaataatcaaattttagatttatttggtaatttaaatttagtttcaacaatttcacca
attataaattcaattcaacaattagttacaagttcaaccaataataataataatggtata
attagattaaataatggtttaattaattcaaatttaataattggtaatgattcaagttta
atttataaattaaattgtcaattaatcggtggtacaattggtggtacaattaattcaatt
ggtggtttatttttaccaaatcaattaaatttattagaaaaattaaatttaaatttaaaa
agtttattaattgattctggtcaaattttattaaataattcaattttaaatattaaagat
tcaattggtttcaataacaatgtaattggtacaatgaatttaacaaatagtttattagaa
ttaggtggtaacatttttaataatacttcaaattcatttaaagatttattattaataaat
gttaaattatcagcaaataatttaattttaaatattgcaaataatattattctaccaaat
cgtatttcattaggtattggttcaactttacactttgtaaatggtattgaaaatgattta
aaatttcaaacaactttagatttaaatttattaaattcaattttaaatacaaattttgtt
tttgtaatttcaacatcatctttaatattttgtaatggtcaatcaccaccaactatgata
caattacatggtagttcaacttcaacctatcaatttatgtgtgataataatatgattgta
atgagattaaccaattgttttggtggttatatttgtccttcaaatgatcaatgtgtatca
aatgaatcacaatgttcatcaattgatgatcaatcggcagtattaccagcttgtaatgta
aatgaaattcgttgtttatcaggttgtcattcaaatattgattattgtaataatactcaa
tgtataagtgagggtggtacaattgaatgtttatcaccaaccactgccaaaagtttaaaa
tataatggttgtccatttaattattttcaatgtggtgatggttcttgtcatttaaataaa
ttggattgttgtgttgttggtataaattgtactcaatctttattggtttcaacatttgtt
aaaccagaattatcgtactctccaattcatactttaaaagatatgaaagttccaatcatt
tcaaaatcgaaatcaactggaattttagatatttatggttacgtttcaatgccaagtggt
ttcttaactataaattcactaagtaaattaaaaataacctataaagatgattcttattta
gattcagtaaatggtgatgaaatttggggtattgattcaaatatatctcaatatagacag
tctgcaattagtatgatattcgatatttcaatcgatacaattccaaatccaatttttaat
cataatataacatttgaattaaaagttaataatcttcaacttttaaatttatcaaattat
tgtctttactatattaatactactcaaaataaatggaattgtgaaactagttcaactatt
tcaatatctccaagaaatactttgttagttacaactcctcatttcactgattttggtgtt
ttacttaataattataaacctcaaacaactcgtccacctgctggtggtggtacttggaca
aatccaacatttacaacaactggtactacaactggtactactactgcaactacaactgca
actactactgcaactacaactgcaactacaactgcaacaggtagttcaaatcctactaca
acaacaactactaatcaacaaacaacaacaacaacaatttctcaaaccaccaatggaggt
gatggatcatcaattgatacaacaactgggggatcatcaaatcctactactactggtact
acaactgcaacaacttcaggtactacaactgctacaactactgctacaactactgcaaca
acaactgcaacaacaactgcaacaacaactgcaacaacaactgcaacaacaactgcaaca
acaactgcaacaacaggtgtaacattaacagaagaaccaatatcagatgaagaagatagt
aataaaaatacaattataatgtcaacaacaatatcaggtggtgcattagttatagctggt
gtatcatcttattttataaataaaagaataagacatggtcgtgtagtatattggtggaaa
cttagaaaaccacctccctctcaacttgaattaagtacaactacaacaaaagtttaa

DBGET integrated database retrieval system