KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287243
Entry
DDB_G0287243      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DDB_G0287243
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0287243
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     DDB_G0287243
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     DDB_G0287243
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     DDB_G0287243
SSDB
Motif
Pfam: DCP1 CCDC53
Other DBs
NCBI-GeneID: 8626034
NCBI-ProteinID: XP_637336
dictyBase: DDB_G0287243
UniProt: Q54KM1
Position
5
AA seq 358 aa
MSTLESQQQNLSALQRLDSKICGVLGTSTHVTAYKFDESVKQWFRKDIEGSLFIVNTTEY
PYCKLIVMNRLSTKNLVEEINEKIVIRIQGQYLIYKNKSGEINGIWFYEVTDQEKIYNLL
KDLQRNPPQPPQIQQQPQPQQPQQQQQQQQQQQPPQPQQQPPQQMQQQPPGTMSPQGMIP
PPGFIIPQGGIPPHPQFMPQSHVYPYMMQPQQIQPNYNNNSSNNNNNNNNSSNNNSSNNN
NSNPPTPNKQNINDTPITPNTIINQIQQNSTQSNNSNNINNNNNSNNINNNSKTTPYSTT
PQQLSPTIKKEVPLLSVLMNSVVVKENTITKDQIRETLKRLVNDENFIDLVYNSYINE
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcgactttagaatcgcaacaacaaaatctttcagcattacaaagattagatagtaag
atatgtggtgttttaggaacatcaacacatgtaactgcctataaatttgatgaatctgtt
aaacaatggtttagaaaagatatagaaggttcattatttatagtgaacacaacagaatat
ccatattgtaaattaattgtaatgaatagattaagcacaaagaatttagtagaagagatt
aatgaaaagattgttattagaattcaaggtcaatatttaatatataaaaataaaagtggt
gaaatcaatggtatttggttttatgaagtaactgatcaagaaaagatttataatttatta
aaagatcttcaaaggaatccaccacaaccaccacaaatacaacaacaaccacaaccacaa
caaccacaacaacaacaacaacaacaacaacaacaacaaccaccacaaccacaacaacaa
ccaccacaacaaatgcaacaacaacctccaggtactatgtcaccacaaggtatgatacca
cctccaggttttataattccacaaggtggtatacctcctcatccacaatttatgcctcaa
tctcatgtttatccatatatgatgcaaccacaacaaattcaaccaaattataataataat
agtagtaataataataataataataataatagtagtaataataacagtagtaataataat
aatagtaatccaccaacaccaaacaaacaaaatataaatgatacaccaattacgccaaat
acaataataaatcaaattcaacaaaattcaacccaatcaaacaatagtaataatatcaat
aataataataatagtaataatatcaataataatagcaaaactactccatattcaaccact
ccacaacaattatcaccaacaattaaaaaagaagtaccactattatcagtattaatgaat
tcagttgtagttaaagagaatacaataacaaaagatcaaattagagaaaccttaaaaaga
ttagtgaatgatgaaaactttattgatttagtttataactcttacattaatgaataa

DBGET integrated database retrieval system