KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287327
Entry
DDB_G0287327      CDS       T00245                                 

Gene name
prmt5
Definition
(RefSeq) Skb1 family protein
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    DDB_G0287327 (prmt5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0287327 (prmt5)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0287327 (prmt5)
Enzymes [BR:ddi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     DDB_G0287327 (prmt5)
Spliceosome [BR:ddi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    DDB_G0287327 (prmt5)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     DDB_G0287327 (prmt5)
SSDB
Motif
Pfam: PRMT5_TIM PRMT5 PRMT5_C Met_10
Other DBs
NCBI-GeneID: 8626071
NCBI-ProteinID: XP_637240
dictyBase: DDB_G0287327
UniProt: Q54KI3
Position
5
AA seq 642 aa
MINSAQYEFSCGVELESVDIQLDIERAYDLEYQFIMTSISHPRFNRDFTKASIGNSFSNK
VAFTRSDTLLQSNYWRSSIVGKTSTNGIDLDSIDPTIRSNSVKTLKQEISWAAHLSLPSI
LLPTPSFNSTNYAQVVNQSLQSLSYMKVWIRIPLVSPKSQLLNKFDYYQDHNTSGGSGNN
LVDNDNPWEWWNNFRLLCNQHPNLSAVLEMTSDLPSKEQLQQWLGEPVKCVIIPTSVFLT
NKAGFPTLSKAHQQFLLQLFNYNIQFVVSGASMDTLKDYKTYLKFLHTNQNPLTQEEYFE
MPYLDFLQAPLQPLMDNLESQTYEVFEKDPIKYKQYQNAVRLALLDLDKKDSKDDPIIIM
VVGAGRGPLVNSSIQASIEANKFVKVFAVEKNPNAIVTLRNRIIMEGWEEIVTVIDSDMR
DWNTEYRADIMVSELLGSFGDNELSPECLDGAQRYLKKDTGISIPTWYTSYIAPISSSKL
FNEVTAYGDLKHSETPYVVKPHNFHQLAESKPLFTFSHPNRDEIIDNSRYESLEFELTIP
STTCHGFIGYFDCCLYKDVHISINPSNFSTGMFSWFPIYFPLKQPVYFSNGNLNNNNNNN
IKAKCAFWRNVSKSKVWYEWCLLSPTITPIQNVGGRSYYIGL
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgataaatagtgcacaatatgaattttcatgtggggttgaattagaatcggttgatatt
caacttgatatcgagcgtgcatatgatttggaatatcaatttataatgacctcaatttca
catccaagatttaatcgtgattttaccaaagcatcaattggtaatagttttagtaacaaa
gtagcatttacaagatcagatacattattacaatcaaattattggagatcatcaatcgtt
ggtaaaaccagtaccaatggtatagatttagattcaattgatccaacaattcgtagtaat
agtgttaaaacattaaaacaagagatatcatgggcagcacatttatcattaccatcaatt
ctcttaccaacaccatcattcaatagtacaaattatgcacaagttgtaaatcaatcactc
caatcactttcctatatgaaagtttggattagaataccattagtttcaccaaaatcacaa
ttattgaataaatttgattattatcaagatcataatactagtggtggtagtggtaataat
ttagttgataatgataatccatgggaatggtggaacaattttagattactttgtaatcaa
catccaaatttatcagcagttttagagatgacatcagatttaccatcaaaagaacaatta
caacaatggttaggtgaaccagtgaaatgtgtaattataccaacatcagttttcttaact
aataaagcgggttttccaacattatcaaaagcacatcaacaatttcttttacagctattc
aactataatattcaatttgttgttagtggtgcatctatggatactttaaaagactacaaa
acctatttgaaatttttacatacaaatcaaaatccattaactcaagaggaatactttgaa
atgccatatttagatttccttcaagcaccacttcaaccattaatggataatttagaatca
caaacttatgaagtctttgaaaaagatccaatcaaatataaacaatatcaaaatgctgtt
agattggctttattggatttggataaaaaagattcaaaagatgatccaatcattattatg
gtagttggtgctggtagaggtcctttagtaaattcttcaattcaagcttcaattgaagct
aataaatttgttaaagtttttgctgttgaaaaaaatccaaacgctatcgttacattaaga
aatagaattataatggaaggatgggaagaaattgttacagttattgatagtgatatgaga
gattggaatacagaatatagagcagatattatggttagtgaattattaggatcatttggt
gataatgaattaagtccagaatgtttagatggagcacaaagatatttaaaaaaagataca
ggtattagtattccaacttggtatacctcttatattgcaccaattagttcatcaaaactt
tttaatgaagttactgcctatggtgatttaaaacattcagaaacaccatacgttgttaaa
cctcataatttccatcaattagcagaatcaaaaccattatttacattctcacatccaaat
agagatgaaatcattgataactctagatatgaatcattagaatttgaattaacaattcca
tcaaccacttgtcatggtttcattggttatttcgattgttgtctatataaagatgttcat
ataagtattaatccaagtaatttttcaactggtatgtttagttggtttccaatttatttc
ccattaaaacaaccagtttatttctcaaatggaaatttaaataataataataataataat
ataaaagctaaatgtgcattttggagaaatgtttcaaagagtaaagtttggtatgaatgg
tgtttattatcaccaacaattactccaattcaaaatgttggtggtagatcatattatatt
ggtctttaa

DBGET integrated database retrieval system