KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287543
Entry
DDB_G0287543      CDS       T00245                                 

Name
(RefSeq) BCAP29/BCAP31 family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Bap31 Bap31_Bap29_C HALZ Mod_r UvrB Com_YlbF DUF948 Fzo_mitofusin DHHC
Other DBs
NCBI-GeneID: 8626182
NCBI-ProteinID: XP_637181
dictyBase: DDB_G0287543
UniProt: Q54K74
Position
5
AA seq 195 aa
LLVEIVFCTFFMLPVSMHLRKNVYNKLDKLFGGQNAKIFLKVLALLVIIVFCDSIVNSYN
INKKLHTPELTGAKFDRQNEYTRMFRYQRNSYICGFCLYLFFLIYRSQGIISQLSNVEAS
KTAIEKQTKNNLNTVETLLSENEKLKTEIKDLKKMEKEHKAMKSQAENTTKEYLKLQEEY
NQLLGKKPKTQKKDD
NT seq 588 nt   +upstreamnt  +downstreamnt
ttattggttgaaattgtattctgtactttttttatgttaccagtttcaatgcacctaaga
aagaatgtttacaataaattagataaattatttggtggtcaaaatgcaaagatcttttta
aaggtattggcattgttagtgatcattgtattttgtgattcaattgtaaattcatataat
atcaacaagaaattacatacaccagaattgaccggagctaaatttgacagacaaaatgaa
tatacccgtatgtttagatatcaaagaaattcatacatttgtggtttctgtctctattta
ttctttttaatctatcgttcacaaggtatcattagtcaattatcaaatgtagaagcctca
aaaactgccattgaaaagcaaactaaaaataatttaaataccgtcgaaactctcttatcg
gaaaatgaaaaattaaaaactgaaattaaagaccttaaaaagatggaaaaagaacataaa
gctatgaaatctcaagctgaaaatacaaccaaagaatatcttaaactccaagaagaatat
aatcaacttttaggtaaaaaaccaaaaactcaaaagaaagatgattaa

DBGET integrated database retrieval system