KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288105
Entry
DDB_G0288105      CDS       T00245                                 

Gene name
oxct
Definition
(RefSeq) 3-oxoacid CoA-transferase
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00072  Synthesis and degradation of ketone bodies
ddi00280  Valine, leucine and isoleucine degradation
ddi00650  Butanoate metabolism
ddi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DDB_G0288105 (oxct)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    DDB_G0288105 (oxct)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0288105 (oxct)
Enzymes [BR:ddi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     DDB_G0288105 (oxct)
SSDB
Motif
Pfam: CoA_trans
Other DBs
NCBI-GeneID: 8626466
NCBI-ProteinID: XP_636911
dictyBase: DDB_G0288105
UniProt: Q54JD9
Position
5
AA seq 509 aa
MLSRNLKTLVKNKNILYFTTSTSKSNKIYENAKEAVKDIPNGSKLLVGGFGLCGIPENLI
SAVRDTGVKDLTVVSNNAGVDDFGLGVLLKSRQIKRMISSYVGENATFESQYLKGELEVE
LTPQGNLAERLRAGGAGIPAFYTSTGVGTVLVEEGGFPIKYANDGSGKVEIKSEPRPTQL
YNGRKYCLEESITGDYALIKAWKADTRGNLVFRNTARNFNPPMATAAKITIAEVEEIVDA
GEIKPDEVHVPGIYIQRIVKGPSFEKRIERLTVQKEKTGEAAAKPKDEAAAKRERIVRRA
ALEFEDGMYCNLGIGMPTLASNFIPKGIRIELQSENGLLGMGPFPKMGEHDADLINAGKE
TVTTIPGSSIFSSADSFAMIRGGHVDLTILGGMQVSGNGDLANWVIPGSMVKGPGGAMDL
TSSGSRVVVIMEHTTKHGKPKILKNCTLPLTGKSCVNRIITELAVFDVVNGKLELIEVVD
GQTVDDIKSKTEAEFTVSKNLKPLQQVEI
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgttatcaagaaatttaaaaactttagttaaaaataaaaatatattatattttactaca
tcaactagtaaatcaaataaaatttatgaaaatgcaaaggaagcagttaaagatattcca
aatggttcaaaattattagtaggtggatttggactttgtggtattccagagaatttaata
tcagcagtacgtgatacaggtgtaaaggatttaacagttgttagtaataatgcaggtgtt
gatgattttggattaggtgttttattaaagagtagacaaattaaaagaatgatctcatca
tatgttggtgagaatgcaacctttgagagtcaatatctcaagggtgagcttgaagtagag
ttaacaccacaaggtaatttagcagagagattaagagcaggtggtgcaggtattccagct
ttctatacaagtacaggtgttggtacagtgttggtggaagaaggtggtttcccaatcaag
tatgcaaatgatggttcaggtaaagttgaaattaagagcgaaccacgtccaactcaactt
tacaatggtcgtaaatattgtttagaagaatcaatcactggtgattacgcattgattaaa
gcatggaaagctgatactagaggcaatttagtatttagaaataccgcacgtaatttcaat
ccaccaatggcaacagcagccaaaatcaccattgcagaggttgaagaaatcgttgatgct
ggtgaaattaaacctgatgaagttcatgtaccaggtatttatattcaacgtattgttaaa
ggtccatcatttgaaaaacgtatcgaacgtttaacagtccaaaaagagaaaactggtgaa
gcagctgccaaaccaaaggatgaggcagcagccaagagagagcgtatcgtacgtcgtgca
gctttagagtttgaagatggtatgtattgtaatcttggtattggtatgccaacattggcc
agtaatttcattccaaagggtattagaatcgaattacaatcagagaatggcttattaggt
atgggtccattcccaaaaatgggcgaacatgatgccgatttaatcaatgcaggtaaggaa
accgttacaaccattccaggttcttccattttctcaagtgctgattcattcgcaatgatt
cgtggtggtcatgttgatttaacaattcttggtggtatgcaagttagtggtaatggtgat
ttggccaattgggtcattcctggctcaatggttaaaggtccaggtggtgctatggattta
acttcaagtggttcacgtgtagttgtcataatggaacataccacaaaacatggaaaacca
aagattttaaagaattgtacacttccactcactggtaaatcttgtgtaaatagaatcatc
actgaattggcagttttcgatgtcgtcaatggtaaattagaattaattgaagtcgttgat
ggccaaacagttgatgatattaaatctaaaactgaagcagaatttactgtttcaaaaaat
ttaaaaccattacaacaagttgaaatttaa

DBGET integrated database retrieval system