KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288619
Entry
DDB_G0288619      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-RING_UBOX zf-RING_10 zf-C3HC4 zf-C3HC4_3 zf-RING_6 zf-C3HC4_4 zf-RING_5 zf-rbx1 zf-Nse
Other DBs
NCBI-GeneID: 8626717
NCBI-ProteinID: XP_636636
dictyBase: DDB_G0288619
UniProt: Q54IP3
Position
5
AA seq 275 aa
MNNPFNKNGNNNITFKYLEPEKIDNGLECAICLEVLNDPVVESQCGQMFCRECINNAISV
KPICPLCNQMASIGIVAKYVSNKLNEALVTCTLCDDVSSIKRGEYKSMHLDKQCKSQHCE
GCGSKFTRSEFDHHIKFDCSMAIVNCSGQDILCPFRSTKSEVSIHEINCYHLSLRTVLSD
LIKSNKEKDEKIKKLETQLLFQQNTSGIGIGSNDALVNQQIKNQQFQLLQQQNLLGQTQQ
QVQQQYFLQQQQLLQQQRQHQLSQLNSFQDGLYRP
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaataatccttttaataaaaatggaaataataatattacatttaaatatttagaacct
gagaaaatcgataatggattagaatgtgcaatttgtttagaagtattaaatgatccagtt
gtggagagtcaatgtggtcaaatgttttgtagggaatgtataaataatgcaatatcagtt
aaaccaatttgtccattatgtaatcaaatggcatcgattggaatcgtagcaaagtatgta
tcaaataaattaaatgaagcattagtgacatgtacattatgtgatgatgtatcgtcaatt
aaaaggggtgaatataaatcaatgcatttggacaaacaatgtaaatcacagcactgtgaa
ggttgtggatccaaattcacccgatccgaattcgatcatcatattaaattcgattgttca
atggcaattgttaattgcagtggtcaagatattttatgtccattcagatctacgaaatca
gaagtttcaatacatgaaatcaattgttaccatttatctctaagaacagttttaagtgac
ttaattaaatcaaataaagaaaaagatgaaaaaatcaagaaattagagacccaattatta
tttcaacaaaacactagtggcattggtattggtagtaatgatgctttagttaatcaacaa
attaaaaatcaacaatttcaattattacaacaacaaaaccttttaggacaaactcaacaa
caagtccaacaacaatatttccttcaacaacaacaattattacaacaacaaagacaacat
caattaagtcaattaaattcttttcaagatggattgtacagaccttaa

DBGET integrated database retrieval system