KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288795
Entry
DDB_G0288795      CDS       T00245                                 

Definition
(RefSeq) AKT family protein kinase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like Kdo
Other DBs
NCBI-GeneID: 8626810
NCBI-ProteinID: XP_636525
dictyBase: DDB_G0288795
UniProt: Q54IF2
Position
5
AA seq 641 aa
MLKDIYNSLLSKKQEESNMAAWNNEDILETQAQLFFSIKSIKGLKIMDNPIKVYCLASLE
KQSVQTSSIVINKDQSQIEWNEGYTFDVISSKSILALSIWQGNANVTIANNSIEGGGSSN
NSKLVGKLYIPFATFKKQFCDQWFPLTGTSQSVSIHVKTSFTNSSKKVTVDDFIFLRMIG
RGAFGQVNLVKKIDTGRLYAMKVIKKDKCLNMNAVGHTFTERKLLKKYYHPFIVGLKYSF
QTQDSLCMVLDYIGGGELFYHISERETFSEETARFYIGQIMLAIGFLHEHGVIYRDLKLE
NLLMDLDGNICLVDLGLCKEGIQEGHVTYTMCGSPEYVAPEIINGTGYSKSVDWWALGTL
FYEMIAGLPPFYSEDPHEMTKLILSSPLKFPPQISKNAASLVSLLLNRDPSKRLGSGESD
VEEIKAHPFFKNVNWSKLLNKEVDPPFKPHLVGPLDLSYFDPLCTMNSQPINPYTINSNL
SDQDQMAFQGFSYSAPDIFLNNNNNTTTSNTNIGGSGSNSGSAQNSPYNSLRNTPPSIIS
MMKMSGSSGGFERMSPGHFSPISVNKQQQIQQQQQQHHQPPPLLQPQPQFWVQPQHPNHI
PQPMAQLPILSKLQETTFERRRSLSVNAQTQFTLVLDPNEE
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgttaaaagatatttacaattcattgctatcaaagaagcaagaagagagtaatatggcg
gcgtggaataatgaagatatattggaaactcaagcacaattatttttttcaataaagagt
ataaaaggtttaaaaataatggataatccaataaaagtttattgtttggcatcacttgaa
aaacaatcagttcaaacttcttcaatagtaataaataaagatcaatcacaaattgaatgg
aatgaaggttatacatttgatgtaatatcatcaaaatcaatattagcattatcaatatgg
caaggtaatgcaaatgtaactatagcaaataatagtatagaaggtggtggtagtagtaat
aatagtaaattagttggtaaactttatataccatttgcaacatttaaaaaacaattttgt
gatcaatggtttccattaactggtacaagtcaatctgtatcaattcatgttaaaacaagt
tttacaaattcaagtaaaaaagtaacagttgatgattttatatttttaagaatgattggt
agaggtgcatttggacaagttaatttagtaaagaaaattgatactggtagattatatgca
atgaaagttataaaaaaagataaatgtttaaatatgaatgcagttggacatacatttact
gaaaggaaattattaaagaaatattatcatccatttatagttggattaaagtattcattt
caaacacaagatagtttatgtatggttttggattacattggtggtggtgaattattttat
cacatttcagaaagggaaacatttagtgaggagacagcaagattctatattggtcaaatt
atgttagccattgggttcctacatgaacatggtgtaatctacagggatttgaaattagag
aatttgttaatggatttggatggtaatatttgtttagtggatttgggcctatgtaaagag
ggtatccaagagggccatgtcacctacacaatgtgtggctcacccgaatatgtcgcacct
gaaatcatcaatggtacaggctatagtaaatcggtggactggtgggcattgggcacacta
ttctacgagatgatcgctgggttgcccccattctacagtgaggatccacatgaaatgaca
aagttaatcctttcgtcacctttaaaattcccacctcaaatttcaaaaaatgcagcaagt
ttagtttcattactcttaaatagagacccatcaaaaagattaggttctggtgaatctgat
gtagaggagattaaagctcatcctttctttaagaatgtaaattggtcaaaattattgaat
aaagaagttgatccaccttttaaacctcatttagtgggtccactggatttatcttatttc
gatccactttgtacaatgaattcacaaccaatcaatccttatactataaattcaaatctt
tctgatcaagatcaaatggcatttcaaggtttttcttattctgcacctgatatattttta
aacaacaacaacaatactactaccagcaacaccaatattggtggtagtggaagtaatagt
ggtagtgctcaaaattcaccttataattcattaagaaatacaccaccatcaatcatttca
atgatgaaaatgtctggtagtagtggtggtttcgaaagaatgtcacctggtcacttttct
ccaatctctgtaaataaacaacaacaaattcaacaacaacaacaacaacatcatcaacca
ccaccattactacaaccacaaccacaattttgggtacaaccacaacatccaaatcatata
cctcagccaatggctcaattaccaattttatcaaaacttcaagaaactacatttgaaaga
cgtagatcattatcagttaatgctcaaactcaatttactcttgtattagatccaaatgaa
gagtaa

DBGET integrated database retrieval system