KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288963
Entry
DDB_G0288963      CDS       T00245                                 

Definition
(RefSeq) peptidase M14 family protein
  KO
K07752  carboxypeptidase D [EC:3.4.17.22]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0288963
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.22  metallocarboxypeptidase D
     DDB_G0288963
Peptidases and inhibitors [BR:ddi01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   DDB_G0288963
SSDB
Motif
Pfam: Peptidase_M14 CarbopepD_reg_2 CarboxypepD_reg AstE_AspA DUF2817
Other DBs
NCBI-GeneID: 8626885
NCBI-ProteinID: XP_636502
dictyBase: DDB_G0288963
UniProt: Q54I77
Position
5
AA seq 544 aa
MKILTIYLLIIYFIVFIKNVVNCEIEQLMINGCEKFDESGDVCIKLKKLNFYTINSVGQP
LTRDLLDYVENQLSINQDDNKLILTSENQFNVYLNEDQFKFLNEKKKEFGLEIKLNLVKN
LEEILGTTIQTEMDKLKRITVLLESMRYNYNKGGSSTAYGQSPFLVRSESGIIDYNHYLN
YNQLTDFMKKISNYYPNQSKLYSIGKSSLGRELWAIDLSNFQLKKNNNNKFKQNVKLVGN
MHGDEVVGRQMLIYLIDHLLYRNSKVDKEYVELFENLIISIVPSMNPDGYELGQRENANH
FDLNRNFPDKFVGSSSELYKKIQPEVQSIIDWSKERNFVMSANLHGGSLVANYPFDSTRD
SDNGYGFGIQYPTTDDVVFRRMALTYSLNHAKMYQSKEFLGGIVNGAKWYTLRGGMQDYN
YDFTNGMEITLELSSEKIPKSIELNRFWNDNRNALVKFISLPLSMSIFGRVTNNNNENLF
AQIQISNIDKIVTTDPSNGYYSRLLDDGFYNVTVSSFGYKSITKSILLNPNSRENIDFIL
DFEN
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgaaaattttaacaatttatttattaattatttattttatagtatttattaaaaatgtt
gtaaattgtgaaattgaacaattaatgattaatggttgtgaaaaatttgatgaaagtggt
gatgtttgtataaaattaaagaaattgaatttttatacaatcaattcagttggtcaacca
ttgacaagggatttattggactatgttgaaaatcaattatcaatcaaccaagatgataat
aaattaatattaaccagtgaaaatcaatttaatgtttatttaaatgaagatcaatttaaa
tttttaaatgaaaaaaagaaagaatttggacttgaaatcaaattaaatttagtgaaaaat
ttagaagaaattttaggaactacaattcaaactgaaatggataaattaaaaagaattaca
gttttattagaatcaatgcgttataattataataaaggtggtagtagtactgcatatgga
caatcaccatttttagttagatcagaatctggtatcattgattataatcattatttaaat
tataatcaattaactgattttatgaaaaaaatttcaaactattatccaaatcaatcaaaa
ttatattcaattggtaaatcatcattgggtagagaattatgggcaattgatttatcaaat
tttcaattaaaaaaaaacaataataataaatttaaacaaaatgttaaattagttggtaat
atgcatggtgatgaagttgttggtagacaaatgttaatttatttaattgatcatttatta
tacagaaattcaaaagttgataaagagtatgtcgaattatttgaaaatttaattatttca
attgtaccatcaatgaatccagatggatatgaacttggtcaaagagagaatgcaaatcat
ttcgatttgaatagaaattttccagataaatttgtgggatcaagtagtgaactttataaa
aagattcaacctgaagttcaatcaatcatcgattggagtaaagaaagaaattttgtaatg
tctgcaaatctacatggtggctcattagttgccaactacccattcgattcgaccagagac
agtgataatggctatggattcggtattcagtatccaacaaccgatgatgtcgtattcaga
agaatggcattgacatattcattgaatcatgctaaaatgtatcaatcaaaagaattcctt
ggtggaattgtcaacggtgctaaatggtacactctcagaggtggcatgcaagattacaac
tatgacttcaccaatggtatggaaatcacattagaactatcatcagagaaaattccaaaa
tcaattgaattaaatagattttggaatgataatcgtaatgcattggttaaattcatttca
ttaccactatcaatgagtatctttggtagagtcactaataataataatgagaatttattt
gctcaaattcaaatttcaaatattgataaaattgtaacaactgacccctcaaatggttat
tattcaagattattagatgatggtttctataatgtaacagtttcaagttttggttataaa
tcaattacaaaatcaatacttttaaatccaaattcaagagaaaatattgattttatttta
gattttgaaaattaa

DBGET integrated database retrieval system