KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289085Help
Entry
DDB_G0289085      CDS       T00245                                 

Gene name
mmsdh
Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00280  Valine, leucine and isoleucine degradation
ddi00410  beta-Alanine metabolism
ddi00562  Inositol phosphate metabolism
ddi00640  Propanoate metabolism
ddi01100  Metabolic pathways
ddi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0289085 (mmsdh)
   00562 Inositol phosphate metabolism
    DDB_G0289085 (mmsdh)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0289085 (mmsdh)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0289085 (mmsdh)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     DDB_G0289085 (mmsdh)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     DDB_G0289085 (mmsdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 8626954
NCBI-ProteinID: XP_636395
dictyBase: DDB_G0289085
UniProt: Q54I10
Position
5
AA seq 528 aa AA seqDB search
MLSFKFAKSASKVIGNRNFHSSSASLANTTKLFINGKFVESKTKEWLEVRNPATQELVTK
VPVSTKEEMEAAVKAASDAFPAWRDTSVSNRSRIISNYKNLINKNMDKIAAIITEEQGKT
LPDAKGDVFRGLEVVEHSVNVASLMMGETVENVSKNVDIYSYVQPLGVCAGITPFNFPAM
IPLWMFPLAIACGNTFVLKPSERVPSASMFLVQLAQEAGVPDGVVNVIHGGKEAVNFICD
APEVRAISFVGADQAGRHIHARGTANGKRVQSNMAAKNHATIVPDAHKERTLDALTGAAF
GASGQRCMALSAAVFVGESKNWIPELAERAKKLKVAGGAAPGADLGPVISAASKQRIHEL
IQSGIDEGAKCILDGRNVVVDPEFSKGNFVGPTILTDVKPHMRCYKEEIFGPVLVCLNVD
TVDQAIQLINANPYGNGTAVFTSSGAVARKYQREIDVGQVGINLPIPVPLPFFSFTGSRG
SFVGAGHFYGKTGVQFFTQIKTITSNWRDDDISHGVSSSMNMPILGKN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctttcattcaaattcgccaaatctgcctcaaaggttattggaaatagaaatttccac
tcaagttctgcttctttagcaaatacaactaaattatttattaatggtaaatttgttgaa
tcaaaaactaaagaatggctcgaagttagaaatccagccactcaagaacttgtaactaaa
gtaccagtttcaactaaagaagagatggaggccgcagttaaagcagcatcagatgctttc
ccagcatggagagatacatcagtttcaaacagatcaagaatcattagcaactataagaat
ttaatcaataaaaatatggataaaattgcagcaatcattacagaagaacaaggtaaaacc
ctcccagacgcaaagggtgatgttttcagaggtttagaagttgttgaacattcagtcaat
gttgcatcattaatgatgggtgaaaccgttgaaaatgtttcaaagaatgtcgatatctat
tcatacgttcaaccattaggtgtttgtgcaggtatcactccattcaatttcccagcaatg
attccattatggatgttcccattagcaattgcatgtggtaacacttttgttttgaaacca
tcagaacgtgtaccatcagcatccatgtttttagttcaactcgcacaagaagctggtgta
ccagatggtgttgtcaatgttattcatggtggtaaagaagctgtaaactttatttgtgat
gctccagaagttagagccatctcattcgttggtgccgatcaagctggtcgtcatattcac
gctcgtggtactgccaatggtaaacgtgtacaatctaacatggctgctaaaaatcacgcc
accatcgtcccagatgcccataaagaacgtactttagatgcattgactggtgctgctttt
ggtgcctctggtcaacgttgtatggctttaagtgctgctgtattcgttggtgaatctaaa
aattggattccagaattagctgaacgtgccaagaaattaaaggttgcaggtggtgctgca
ccaggtgctgatttaggtccagtgatttcagcagcctcaaaacaaagaattcacgaactc
attcaatctggtattgatgaaggtgccaaatgtattttagatggtcgtaacgttgtcgtt
gatccagaattttcaaagggtaactttgttggtccaaccattctcactgatgtcaaacca
catatgagatgttacaaagaggaaatctttggtccagttttagtttgtctcaatgttgat
actgtcgatcaagccattcaactcatcaatgctaacccatacggtaatggtactgctgtc
ttcacctcatctggtgctgtcgctcgtaaatatcaacgtgaaatcgatgttggtcaagtt
ggtatcaatttaccaatcccagttccacttccattcttctccttcactggttctcgtggt
tcttttgttggtgctggtcacttctacggtaagactggtgttcaattctttactcaaatt
aaaacaatcacttcaaactggagagatgatgatatttcacacggtgtttcttcatcaatg
aatatgccaattttaggtaaaaattaa

DBGET integrated database retrieval system