KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289193
Entry
DDB_G0289193      CDS       T00245                                 

Gene name
H2Av2
Definition
(RefSeq) histone H2A domain-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Histone_H2A_C Histone
Other DBs
NCBI-GeneID: 8627003
NCBI-ProteinID: XP_636330
dictyBase: DDB_G0289193
UniProt: Q54HV9
Position
5
AA seq 286 aa
MKSNGHPSNNSINEPIKQQETKQNNKSSHKTPHKPPYLARAKFQPKTSSFSNSSFQSSTP
PKPQIALKSPSPSPSQPKTSSSSYSSLSSPSPSQPKTSSPSLPSSTPPKPRQIALKSPSS
SSSSQPKTSSSSYSSLPSSTPPKPQHIELKSPSTVKKSPIVKKTNSPKGSKFKKTIRSSR
STRAGLTISVSRVEKLLRGRRYSKRVSPTSCVFLAAVLEYMVLELLELSLNELSLSKKSR
RIKNRHINLSILKDVELSALLNDVIICSGGVLSSIHPSLLKLKKDQ
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaaaagcaatggtcatccctcaaataattctataaacgaaccaataaagcaacaagaa
acaaaacaaaacaataaatccagtcataaaactccacataagccaccatatttagcccga
gcaaaatttcaaccaaaaacatcctctttttcaaattcttcatttcaatcatcaactcca
cccaaaccacagattgcattaaaatccccatcaccatcaccatctcaaccaaaaacatcc
tcatcttcatattcttcattgtcatccccatcaccatctcaaccaaaaacatcctctcct
tcattaccatcatcaactccacccaaaccacgacaaattgcattaaaatccccatcatca
tcatcatcatctcaaccaaaaacatcctcttcttcatattcttcattaccatcatcgact
ccacccaaaccacagcatattgaattaaaatccccatcaactgttaagaaatcaccaatt
gtaaagaaaactaactccccaaaaggatctaaatttaaaaaaacaattcgttcaagtcgt
tctactcgtgcagggttaacaatttcagtttccagagttgagaaattattacgaggaaga
agatacagtaaaagagttagtccaacttcatgtgtttttttagcagctgttttggaatat
atggtacttgaattattggagttatctctaaatgaacttagtctttccaaaaaatcaaga
aggattaagaatagacatattaacctttctattttaaaagacgttgagctcagtgctcta
ttaaatgacgttataatttgtagtggtggtgttttatcctctattcatccaagtttacta
aaactaaaaaaagatcaataa

DBGET integrated database retrieval system