KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289197
Entry
DDB_G0289197      CDS       T00245                                 

Gene name
H2Av3
Definition
(RefSeq) histone H2A domain-containing protein
  KO
K11251  histone H2A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0289197 (H2Av3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0289197 (H2Av3)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    DDB_G0289197 (H2Av3)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0289197 (H2Av3)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 8627005
NCBI-ProteinID: XP_636332
dictyBase: DDB_G0289197
UniProt: Q54HV7
Position
5
AA seq 125 aa
MKRNNNLIIPLLKIKKLLKRKGCKRIQNSALVFFSKVLQYLIEELLEISMNVSILNKTKK
YRIKPKDISWSIQSDPEFNLLFRNIIIPSSGRISNKLNRIIQRSFKFKSFKFDDYEKSDY
SSKTF
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaaagaaataataatttaataataccactactaaagattaaaaaacttttaaaaaga
aaaggatgtaaacgtattcaaaattctgcattagtattcttttcaaaagtattacaatat
ttaattgaagagctattagagattagtatgaatgtttcaattttaaataaaacaaagaaa
tatagaattaaaccaaaagatataagttggagtattcaatctgatccagaatttaattta
ttatttagaaatattataattccatcatcaggaagaatttcaaataaattgaatagaatt
atacaaagatcatttaaatttaaatcattcaaatttgatgactatgaaaaatcagattat
tcttcaaaaacattttaa

DBGET integrated database retrieval system