KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289247
Entry
DDB_G0289247      CDS       T00245                                 

Gene name
apm1
Definition
(RefSeq) clathrin-adaptor medium chain AP-1
  KO
K12393  AP-1 complex subunit mu
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0289247 (apm1)
Membrane trafficking [BR:ddi04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    DDB_G0289247 (apm1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 8627033
NCBI-ProteinID: XP_636252
dictyBase: DDB_G0289247
UniProt: Q54HS9
Position
5
AA seq 428 aa
MAASAIFLMDSKGKVLISRNYRGDVPMSVASKFISKILEEEDLNLKPIIQEDGISYIYVK
HNNLFLLATTERNANAATILLFLYKMIEVFNEYFKELEEESIRDNFVVIYELMDEMMDFG
YPQSTEPKILQEYITQEGYKLERGARGMVLPAAITGAVSWRKEGIKYNKNEVFLDVVESI
NLLVSANGTVLRSEIVGAVKMKSKLSGMPELRLGLNDKILFENSAKTGAPKGKGVELEDV
KFHQCVRLSKFENDRTISFIPPDGEFELMSYRLNTTVKPLIWVECISDTHAHSRVEYMVK
AKSQFKGKSIANNVEIIVPVPPDADTPKFRCTVGTCKYAPEKDAIIWTIKQFPGGGREFL
MRAHFGLPSISDEKPATKPPIMVKFEIPYYTVSGIQVRYLKIIEKSGYQALPWVRYVCLS
GDYQFRTS
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggccgcatcagctatatttttaatggactcaaagggtaaagttctaatctcacgtaac
tatcgtggtgatgttccaatgagtgttgcatcaaaatttatatcaaaaattttagaagaa
gaagatctcaacttaaaaccaatcatccaagaagatggtatctcttatatttatgttaaa
cataataatttatttttattggcaacaacagaaagaaatgcaaatgcggcaacaatatta
ttatttttatataaaatgattgaagtttttaatgaatactttaaagaattagaagaagag
agtattagggataactttgtagtaatttatgaattgatggatgaaatgatggattttgga
tatccacaatctacagagccaaagattcttcaagaatatattactcaagaaggttataaa
ttagagagaggtgcaagaggtatggtattaccagcagcaattacaggtgcagtctcttgg
agaaaagaaggtattaaatataataagaatgaagtatttttagatgttgtcgaatcaatc
aatcttttagtttcagcaaatggtactgtacttagaagtgaaatcgttggtgccgttaaa
atgaaatcaaaattatctggtatgccagaattaagattaggtttaaatgataaaatttta
tttgaaaatagtgcaaagactggtgcaccaaaaggtaaaggtgtagaattagaagatgtt
aaattccaccaatgtgttagattatcaaaatttgaaaatgatagaactatttcattcatt
ccaccagatggcgaattcgaattgatgagttatcgtttgaatacaactgttaaaccattg
atatgggtagaatgtattagtgacacacatgcacattcgcgtgttgaatatatggttaaa
gccaaatcacaatttaagggtaaatcaattgcaaacaatgtagagatcatagtaccagta
ccaccagatgctgatactccaaaattcagatgcactgttggtacttgtaaatatgcacca
gagaaagacgcaatcatttggacaatcaaacaattcccaggtggtggtagagagttttta
atgagagctcattttggtttaccatcaatctctgatgaaaaaccagctactaaacctcca
atcatggttaaattcgaaattccatattacaccgtttctggtatccaagttagatatctt
aaaattattgaaaaatctggttatcaagctttaccttgggtacgttatgtttgtttaagt
ggtgattatcagtttagaacttcttaa

DBGET integrated database retrieval system