KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289449Help
Entry
DDB_G0289449      CDS       T00245                                 

Gene name
ubqF
Definition
(RefSeq) hypothetical protein
  KO
K08770  ubiquitin C
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0289449 (ubqF)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   DDB_G0289449 (ubqF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5
Motif
Other DBs
NCBI-GeneID: 8627148
NCBI-ProteinID: XP_636210
dictyBase: DDB_G0289449
UniProt: P0CG78
Position
5
AA seq 533 aa AA seqDB search
MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttttgttaaaactctcactggtaaaaccatcacattggaagttgaaggtagt
gacaacattgaaaatgtcaaggctaaaattcaagacaaagaaggtattccaccagatcaa
caaagattaatctttgctggtaaacaattagaagatggtcgtactctttctgattacaac
attcaaaaggaatccactctccatttagttcttagattaagaggtggtatgcaaatcttt
gtaaaaactctcactggtaaaaccatcaccttagaggttgaaggtagtgataacattgaa
aatgttaaagctaaaattcaagacaaagaaggtatcccaccagatcaacaaagattaatt
ttcgctggtaaacaattagaagatggtcgtactctctctgactacaacattcaaaaggaa
tccactctccacttggttctcagattaagaggtggtatgcaaatctttgtaaaaaccttg
actggtaaaactatcaccttggaagtcgaaggttctgacaacattgaaaatgttaaagcc
aaaatccaagacaaagaaggtatcccaccagatcaacaaagattaattttcgctggtaaa
caattagaagatggtcgtactctctctgactacaacattcaaaaagaatccactctccat
ttagttttaagattaagaggtggtatgcaaatttttgttaaaactctcactggtaagacc
atcaccttagaggttgaaggtagtgataacattgaaaatgtcaaagccaaaatccaagac
aaagaaggtatcccaccagatcaacaaagattaattttcgctggtaaacaattagaagat
ggtcgtactctctctgactacaacatccaaaaagaatccactctccatttagttttaaga
ttaagaggtggtatgcaaatctttgttaaaactctcactggtaaaaccatcaccttggaa
gtcgaaggtagtgataacattgaaaatgtcaaagccaaaatccaagacaaagaaggtatt
ccaccagatcaacaacgtctcattttcgctggtaaacaattagaagatggccgtactctc
tctgattacaacatccaaaaagaatccactctccatttagttctcagattaagaggtggt
atgcaaatctttgtaaaaaccttgactggtaagaccatcacattggaagtcgaaggttct
gataacattgaaaatgtcaaagccaaaattcaagacaaagaaggtattccaccagatcaa
caaagattaattttcgctggtaaacaattagaagatggtcgtactctctctgactacaat
attcaaaaggaatccactctccatttagttctcagattaagaggtggtatgcaaatcttt
gttaaaactttaacaggtaaaactatcaccttggaagtcgaaggtagtgataacattgaa
aatgttaaagccaaaatccaagacaaagaaggtattccaccagatcaacaacgtctcatt
ttcgctggtaaacaattagaagatggtcgtactctctctgattacaacattcaaaaggaa
tccactctccatttagttctcagattaagaggtggtaactaa

DBGET integrated database retrieval system