KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290157Help
Entry
DDB_G0290157      CDS       T00245                                 

Gene name
pkgB
Definition
(RefSeq) SGK family protein kinase
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0290157 (pkgB)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DDB_G0290157 (pkgB)
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   DDB_G0290157 (pkgB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C FTA2 Haspin_kinase Pkinase_fungal APH Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 8627509
NCBI-ProteinID: XP_635853
dictyBase: DDB_G0290157
UniProt: P28178
Position
5
AA seq 479 aa AA seqDB search
MGKGQSKIKNGGSGKPAKAGKPKKGNKNDETTPTSTPTPTPTPTQQNLDNSAQQQQQQQQ
TTTAAVSLDNKEQQQQQNIPAPATQTPITQTGTPTIEESQKNTDNNNINGASNEASSSPD
SPNGSGNGNDDEDEGPEEVIFSKNKQSATKDDFELLNVIGKGSFGKVMQVKKKGEDKIFA
MKVLRKDAIIARKQVNHTKSEKTILQCISHPFIVNLHYAFQTKDKLYMVLDFVNGGELFF
HLKREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITDFGLSKK
IETTDGTFTFCGTPEYLAPEVLNGHGHGCAVDWWSLGTLLYEMLTGLPPFYSQNVSTMYQ
KILNGELKIPTYISPEAKSLLEGLLTREVDKRLGTKGGGEVKQHPWFKNIDWEKLDRKEV
EVHFKPKVKSGTDISQIDPVFTQERPMDSLVETSALGDAMGKDTSFEGFTYVADSILKD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggacaaagtaaaataaagaatggaggatcaggtaaacccgccaaagcagga
aaaccaaaaaaaggaaataaaaatgatgaaacaacaccaacatcaacacctacaccaaca
ccaacaccaactcaacaaaatttagataatagtgcacaacaacaacaacaacaacaacaa
acgactacagcagcagtttcattagataataaagagcaacaacaacaacaaaatatacca
gcaccagctacccaaacaccaattactcaaacaggtacaccaactattgaagaatcacaa
aaaaatacagataataataatataaatggtgcatcaaatgaagcatcaagttcaccagat
tcaccaaatggtagtggaaatggtaatgatgatgaagatgaaggaccagaggaagtcatt
ttttcaaagaataaacaatcagcaacaaaagatgattttgaattattaaatgtaattggt
aaaggtagttttggtaaagttatgcaagttaagaaaaagggtgaagataaaatctttgct
atgaaagttttacgtaaagatgctatcattgctcgtaaacaagtcaatcatactaaatct
gagaaaactatccttcaatgtatttctcatccattcattgtaaatttacattatgctttt
caaacaaaagataaattatatatggtattagattttgttaatggtggtgaattatttttc
catttaaagagagaaggtagattttcagaaccaagagtaaagatttatgcagcagagatt
gtatcagcattggatcatttacataaacaagatattgtatatcgtgatttgaaaccagag
aatattttattagatagtgaaggtcatatttgtatcactgattttgggttatctaaaaag
attgaaacaaccgatggtacattcactttctgtggtacaccagagtatttagcaccagag
gtattgaatggtcatggtcatggttgtgccgtcgattggtggtctcttggaactcttctc
tatgagatgttaactggtttaccacctttctactctcaaaatgtatcaacaatgtatcaa
aaaattttaaatggtgaattaaaaattccaacttatatttcaccagaagcaaaatcatta
ttagaaggtttattaactagagaagttgataaaagacttggaactaaaggtggtggtgaa
gttaaacaacatccatggttcaaaaatattgactgggagaaattggatagaaaagaagtt
gaagttcactttaaaccaaaagttaaatctggcacagatattagtcaaattgatccagtt
ttcactcaagaaagaccaatggatagtttggttgaaacaagtgctttaggtgatgctatg
ggtaaagatacaagctttgaaggtttcacttatgtagctgattcaatcttaaaggattaa

DBGET integrated database retrieval system