KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290237Help
Entry
DDB_G0290237      CDS       T00245                                 

Gene name
acbd6
Definition
(RefSeq) acyl-CoA binding protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: ACBP Ank_4 Ank_5 Ank_2 Ank Ank_3 Par3_HAL_N_term GPAT_N
Motif
Other DBs
NCBI-GeneID: 8627558
NCBI-ProteinID: XP_635850
dictyBase: DDB_G0290237
UniProt: Q54GC8
Position
5
AA seq 288 aa AA seqDB search
MTDAQIENKFKLAVDYITNNSGKLSNIKNEEQLYLYCNYKQATIGDCNTKAPPFYDYIGK
SKWNSWNSLKGVEKIVAMNSYISLVNALSPGWDSNIKVERATQSVFLNDEEFKELEKKEK
EEKEELKKLEEENGGEIEKPKSKWMGPVLSKFSLVDDETLEKLEKNTKQDLGYWVSVNDI
ERVKKEIENDKNIINEVDEDGRTALIWACDRGYFEIAKLLIENGSNVNVQDGEGMTPLHY
AVVCDQFEICKLLLSQSSIDKSIKDNSDSIPSDFIDSSTSENIKSLFK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgcacaaatcgaaaacaaatttaaattagcggtagattatataacaaataac
tctggaaagttaagtaatattaagaatgaagaacaattatatttatattgtaactataaa
caagccacaattggagattgtaatacaaaagcaccaccattctatgactatataggtaaa
tcgaaatggaatagttggaattcattaaaaggtgttgaaaaaattgttgcaatgaatagt
tatataagtttagtaaatgcattatcacctggatgggatagtaatataaaagttgaacga
gcaacacaaagtgtttttttaaatgatgaagaatttaaagaattggaaaagaaagaaaaa
gaagaaaaagaagaattaaaaaaattagaagaagaaaatggtggtgaaattgaaaaacca
aaatcaaaatggatgggtccagttttaagtaaattttcattagtagatgatgaaacttta
gaaaaattagaaaagaatactaaacaagatttaggatattgggttagtgttaatgatatt
gaaagagttaaaaaagaaattgaaaatgataaaaatataattaatgaagttgatgaagat
ggtagaacagctttaatatgggcatgtgatagaggttattttgaaattgcaaaactctta
attgaaaatggttcaaatgtaaatgttcaagatggtgaaggaatgacaccacttcattat
gcagtagtttgtgatcaatttgaaatttgtaaacttttactctctcaatcatcaattgat
aaatcaattaaagataattctgactcaattccatctgattttattgattcttcaacaagt
gaaaatattaaatctttatttaaatag

DBGET integrated database retrieval system