KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290333
Entry
DDB_G0290333      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K20756  physarolisin [EC:3.4.21.103]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0290333
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.103  physarolisin
     DDB_G0290333
Peptidases and inhibitors [BR:ddi01002]
 Serine peptidases
  Family S53
   DDB_G0290333
SSDB
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Other DBs
NCBI-GeneID: 8627611
NCBI-ProteinID: XP_635806
dictyBase: DDB_G0290333
UniProt: Q54G77
Position
5
AA seq 598 aa
MRVLLLLVFLVFCIIPAALSFRDTNWSKYNRAGKKETVDFRIALNQRNLDVLENTLLDVS
NPESPNYGKHWTSEQVADLVAPEPYVSKKVANYLKKNGCHNVENHRDYIKATGPVDSVEK
IFSVEMYNYKHNIKSDQAIIRSSETYQVPFEISQYVHIVSGISELPHLKSGPKSQRLRPN
PKDFQATPAPAGPADPGMVVPQTIQQLYGIPSNYQNNQNTSLCLAEFAADRSYQPKDLKT
FAAKTGTPLINVVKNVGPFQPTQPDLESTLDVQYGGATAQTADVWFWTVNGWMYEFSSDL
AATVPAPYVVSMSWGWPEPLQCQQGIGNCTDGESSQDYVNRVNIEFQKIGLRGITLLASS
GDQGAPGDGNPSCTSRDQPISTIFPGASPWVTSVGATMLAAPSTSNPNPIDTSDAPVCGI
HACATSTQEVTCSSPSALITTGGGFSNYSPQPAWQSKAVNAYLNSGVVLPNKKFFNASNR
GFPDVSGLGHNYYIVAADQMNLVDGTSCSSPVIGGIVALLNSYRLDNGKSTLGFINPVLY
AAYASNPAAFNDITVGNNYCTESCCATTGFVATKGWDAVTGLGSPNFKPLLSYIQSLN
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgagagttttgttacttttagttttcctcgtattttgtatcattccagcagctctctca
ttcagagacaccaactggagcaaatacaacagagctggtaaaaaagaaactgtagatttc
cgtattgcactcaatcaaagaaatttagatgtcttagaaaatactttattggatgtttct
aacccagaatcaccaaattatggtaaacattggacttctgaacaagttgctgatttagtt
gcaccagaaccatacgtttcaaagaaagttgcaaattatttaaaaaagaatggttgtcac
aatgttgaaaatcatcgtgattacattaaagcaactggtccagttgattcagttgaaaag
attttctcagttgaaatgtacaattacaaacataatattaaatccgatcaagctatcatt
cgttcatcagaaacctatcaagttccatttgaaatctctcaatatgttcacattgtttct
ggtatctctgaactcccacatctcaagagtggtccaaaatcacaaagattaagaccaaat
ccaaaggatttccaagctactccagccccagctggtccagctgatccaggtatggtcgtt
ccacaaaccatccaacaactctatggtattccatcaaactaccaaaacaaccaaaacact
tcactctgtttagctgaatttgctgcagatcgttcataccaaccaaaggatctcaagacc
tttgccgccaagactggtactccattaatcaatgttgttaagaatgtcggtccattccaa
ccaactcaaccagatcttgaatcaaccctcgacgttcaatatggtggtgccactgcacaa
actgccgatgtttggttctggactgtcaacggttggatgtacgagttctcatcagatctc
gccgccactgtcccagctccatacgttgtctcaatgtcatggggttggccagaaccatta
caatgtcaacaaggtattggtaactgtaccgatggtgaatcatcacaagactacgtcaac
cgtgttaacattgaattccaaaagattggtctccgtggtatcacccttttagcttcttca
ggtgatcaaggtgccccaggtgatggtaatccatcatgtacctcaagagatcaaccaatc
tcaaccattttcccaggtgcctccccatgggttacctctgttggtgctaccatgttagct
gccccatccaccagcaatccaaatccaatcgatacttctgatgccccagtctgtggtatc
cacgcttgtgctacctcaactcaagaagttacctgttcatctccatccgctttgatcact
actggtggtggtttctccaactactccccacaaccagcatggcaatcaaaagctgtcaat
gcttacctcaactctggtgttgtcttaccaaacaaaaaattctttaacgcttcaaaccgt
ggtttcccagatgtctctggtttaggtcacaactactacattgttgccgccgatcaaatg
aacttagtcgatggtacctcttgttcatcaccagtcattggtggtattgttgccttatta
aacagctatcgtttagataatggtaaatcaaccctcggtttcattaacccagtcttatat
gctgcttacgcctctaacccagctgccttcaatgatatcaccgttggtaacaattattgt
actgaaagctgttgtgctaccactggtttcgttgccaccaaaggttgggatgctgtcact
ggtttaggttcaccaaatttcaaaccattattatcatacattcaatctttaaattaa

DBGET integrated database retrieval system