KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290363
Entry
DDB_G0290363      CDS       T00245                                 

Gene name
sybB
Definition
(RefSeq) synaptobrevin domain-containing protein
  KO
K08513  vesicle-associated membrane protein 4
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    DDB_G0290363 (sybB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0290363 (sybB)
Membrane trafficking [BR:ddi04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    DDB_G0290363 (sybB)
SSDB
Motif
Pfam: Synaptobrevin RIFIN DUF1676 DUF5383 Orf78
Other DBs
NCBI-GeneID: 8627574
NCBI-ProteinID: XP_635770
dictyBase: DDB_G0290363
UniProt: Q54GB3
Position
5
AA seq 101 aa
MSNNPNNSGQPNKTQSILQEVDKVKDVMHNNIGLMLNNHDKASNLQDKTASMSNNARLFK
KQTVTIRRQMWCRNMKLQLIIIAVVILVLAVILIPIIMKFV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtcaaataatccaaataattcaggtcaaccaaataaaacacaatcaattctacaagaa
gttgataaagttaaagatgttatgcataataatattggattaatgttaaataatcatgat
aaagcttcaaatttacaagataaaacagcatcaatgagtaacaatgctcgtcttttcaaa
aaacaaactgttacaatcagaagacaaatgtggtgtagaaatatgaaattacaacttatt
attattgctgtagtcattttagtattggctgtaattttaattccaattattatgaaattc
gtataa

DBGET integrated database retrieval system