KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290671
Entry
DDB_G0290671      CDS       T00245                                 

Gene name
rabggtb
Definition
(RefSeq) Rab geranylgeranyltransferase beta subunit
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ddi01006]
    DDB_G0290671 (rabggtb)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0290671 (rabggtb)
Enzymes [BR:ddi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     DDB_G0290671 (rabggtb)
Prenyltransferases [BR:ddi01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   DDB_G0290671 (rabggtb)
Membrane trafficking [BR:ddi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    DDB_G0290671 (rabggtb)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    DDB_G0290671 (rabggtb)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_N SQHop_cyclase_C
Other DBs
NCBI-GeneID: 8627741
NCBI-ProteinID: XP_001733035
dictyBase: DDB_G0290671
UniProt: B0G172
Position
5
AA seq 339 aa
MTDNINKESTTTTTTIDHTTNLLIDKHVEYIVKLGSKKDSFEYWVTEHIRMNGMYWGLSS
LYLLKSLDKLDKNEVIQWLLSCQKSNGGFGGNTSHDDHLLSTLSAVQILIQYDALDKIDI
NSVVDYVVKLQREDGSFVGDQWGEVDTRFSYAAIMCLSLLKSLDKINCEKAVEYILSCQN
FDGGFGSIPGAESHAGQIFTCVGALSILNEINKIDIDKLGWWLSERQLPNGGLNGRPEKS
SDVCYSWWVLSALSAIDRLHWIDNDKLKSYILKCQDNETGGIADKPGDIPDVFHTFFGIC
GLSLMGYFKDQIESIDPVYALGTKTLQKLGLNLPWNKNL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgactgataatattaataaagaatcaaccacaacaacaacaacaattgatcatacaacc
aatttattaattgataaacatgtggaatatatagttaaattaggatcaaagaaggattca
tttgaatattgggtaacagaacatattagaatgaatggaatgtattggggattatcatca
ttatatttattaaaatcattagataaattagataaaaatgaagttatacaatggttatta
tcatgtcaaaaatcaaatggtggattcggtggtaacacttcccatgacgatcatttactt
tcaactttatcagctgttcaaattttaattcaatatgatgctttagataaaatagatatt
aattctgttgtagattatgttgtaaaattgcaaagagaggatggatcatttgttggtgat
caatggggtgaagttgatacaagattttcatatgctgcaataatgtgcctttctttatta
aaaagtttagataaaattaattgtgaaaaagctgtagaatatatattaagttgtcaaaat
tttgatggtggttttggttccattccaggtgctgaatctcatgctggtcaaatttttaca
tgtgttggtgcattatcaattttaaatgaaattaataaaattgatattgataaattagga
tggtggttaagtgaaagacaattaccaaatggtggattaaatggtagaccagagaaatca
tcagatgtttgttattcatggtgggtattatcagcattaagtgcaattgatagattacat
tggatcgataatgataaattgaaaagttatattttaaaatgtcaagataatgaaactggt
ggtatagctgataaacctggtgatattcctgacgtttttcatacattttttggtatatgc
ggtttatcactaatgggttatttcaaagatcaaatcgaatcaattgatccagtttatgca
cttggcactaaaactttacaaaaattaggtcttaatttaccttggaataaaaatttataa

DBGET integrated database retrieval system