KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290771
Entry
DDB_G0290771      CDS       T00245                                 

Name
(RefSeq) Arf guanyl-nucleotide exchange factor
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    DDB_G0290771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0290771
Membrane trafficking [BR:ddi04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    DDB_G0290771
SSDB
Motif
Pfam: Sec7 Sec7_N
Other DBs
NCBI-GeneID: 8627819
NCBI-ProteinID: XP_635561
dictyBase: DDB_G0290771
UniProt: Q54FL9
Position
5
AA seq 1748 aa
MIDPVNIIQGEVYGLISNLKLNSRWSNSSYQDTIFPENPILRSLKNLTNILHNVSDTCIY
LEPFLSVIKSNQTSGFITGAALTSVNKFLNLFIDEESNNIHKGIRDIAEAAAHCKFEATD
ARSDEIVLMKILQVLNSCVKNPAGIYISNDLIYEVTIACYHMSDQSRSSELLKKNAENSV
QEIVSTIFNRYNIYIDPPQPPPIPTPTPISTTSTTTTTPILPVIINTTSTLTTTPTTTTT
PTTTTTTDETEKSQPPPLEVDFSPNNDLFFSNLPTTDENTENTVESTPTPTPTPPPPPVV
QRLPVQQLEQQQQQKGFTINPRGVRFDASNQTDKPYDETVLIRLFKLFVANINTSPSSQD
DTSTKLLCLNLVNTIIQIRGSQLEQIPTILKIIQKDLFKFLLLNLQMKNVQIYSLSMRIF
FNLFIGLKRTLKSQFEAFFNVLMASIQENNKSHYELQELALEGLRDFCKLPHTMIDLFVN
YDCELHCSNVFENLCKFLYKNSFPISQSITSLHLISFENLLSIVQSIEDRRTRSLLLQQK
QDQKQLQQQPQQISNEPKIDYLKRKEHKRQLVIAAEHFNRKPNDAIEYLKNNNLYSPVTP
ENIAKFLLEVPKLNKTTVGEYLGKRGEMNEKVRNHYINSFNLKNPNCMTVFREFLESFKI
PGESAVVQIIFEEFAQKIYENRSDKLFLNADKVYLYIYSALMLHTSLYNPVISQKERMKF
SNFKSMLNKELPDELIQECFDDISENEMIVEEEPQPGVINQPNWRKILMRSKRIGDYKSA
NTNDYDREIFSIVLNLVIPAISKVFEKIENESLCQRILDGFHLCAQVSANYNIIEVIDNL
MTSLCNNTTLIDNTVEQQQQQQQSNLNNTNQNNVNNNNSNVNNNNNNVNQNNVNNNNNNT
NINNINQNNINQNNLNNSNNNNLIPNGTNSPSSNVTTPNQQTTTTTTTNSGTPLSNSNGM
NNNNNNNNNNNTNNNNNNNYYYNENVFIGDNKAQLATIATFEIAIKYSNLLGESWRYIIA
IICRLNKMDLLSNIFETIDFPIDNTSNSKGGKKQEEQKQKQNSTSTFLSFRWFVADSTDY
EEIEVIDPHKEKAKTCVDNCHITDLFQETKSLPMHSLDQLLNSLFNITNPTKQQSSSSSS
SSSTTTTTTSSTSNITTIATVQPSTTTSSSSSLSTTSSSSSTITTTNSPTQQHHHNNYHN
HYGNTSNFYYSINQKQELFCFDLLSHIILLNQDRLGLVWNKYFEHCESIINIFEQVVSVS
TANARLMTPLIEKVVMSIMYLLIRLIRKKEVFSTLSACIKLLLRVGNVLDSIAEKMSISL
IQLVQKNIDFLSTTPSAWEPILALIVLLSGNPKSSNRACDALSLMIKTQPDSLTEETCLH
CLEPINCFIDSKTIPHGVVVKSMELLYFIFTNVTKILGIHKIESGTNDHSSPNGGMVGFQ
TTRILIRKMDVKINTAWVKFWSKILVKFSSLCLDPKPDIRNNAMTFLQKTILSSSLQEFL
PPGRWFDCFVDVVFQLLDNLKENSRETNFEDTRLRASALLSKVFLQNLNTIIKCDQFTTL
WDSILSHLKIYMGLSELLSESVPESLKNMLLVMNNSGVFKPPTGEESEDDISKQLWDSTW
AAIDEFCPKISEDVLSRVDPNYFLKKQQQQQQQQQQQQQLQQQQQQQQHSQSEELKQQQL
LSQIIQQNINSPTIIDTPSVLQQYQQPQLQQPQQPQQPQQQDQEEFNPIMSIPMVPIMPN
NTNNNINK
NT seq 5247 nt   +upstreamnt  +downstreamnt
atgattgacccagttaatataattcaaggtgaagtctatgggttaatatccaatttaaaa
ttaaattcaaggtggtcaaactctagttatcaagatacaatattcccagagaatccaatt
ttaagatcattaaagaatttaacaaatatattacataatgtttcagatacatgcatttat
ttagaaccatttttatcagttataaaatccaatcaaacaagtggatttataactggagca
gcattaacaagtgtaaataaatttttaaatttattcattgatgaagaatctaataatata
cataagggtataagagatattgcagaggcagcagcacattgtaaatttgaagcaaccgat
gctagatccgatgaaatcgttctaatgaagatattacaagtgttgaattcatgtgtaaag
aatccagctggtatttacattagcaatgatttaatttatgaggtaaccattgcatgttat
catatgtctgatcaatcaagatcttcagaactcttaaaaaagaatgctgaaaattccgtt
caagaaattgtttcaaccatttttaatcgttataatatttatattgatccacctcaacca
ccaccaataccaacaccaacaccaatatcaactacttccaccactactactacacctatt
ttacctgttattataaatactacttcaactctaactaccactccaaccactactaccact
ccaacaactacaactaccacagatgaaacagaaaaatcacaaccaccacctttagaagtt
gatttttcaccaaataatgatttattctttagtaatttaccaactacagatgaaaataca
gaaaatacagttgaatcaacaccaacaccaacaccaacaccaccaccaccaccagtagta
caacgactaccagtgcaacaactagaacaacaacaacaacaaaaaggatttacaattaac
ccacgtggtgtaagatttgatgcaagtaatcaaacagataaaccatatgatgaaacagta
ttgatacgtttatttaaattatttgtagccaatataaatacatcaccatcatctcaagat
gatacttcaacaaaattactttgtttaaatttagttaatacaatcattcaaattcgtggt
tcacaattagaacaaattccaactatattaaaaattattcaaaaagatttatttaaattt
ttattattaaatttacaaatgaaaaatgttcaaatttattcattatcaatgagaattttc
ttcaatttatttattggattaaagagaacattgaaatcacaatttgaagcatttttcaat
gttttaatggcatcaattcaagagaataataagagtcattatgaattacaagagttggca
ttagaaggattaagagatttttgtaaattaccacatacaatgattgatctatttgtaaac
tatgattgtgaattacattgttcaaatgtttttgaaaatctttgtaaatttttatacaaa
aattcattcccaatttcacaatcaatcacttcacttcatttaatttcatttgaaaattta
ttatcaatcgttcaaagtattgaagatcgtagaactcgttcattacttttacaacaaaaa
caagatcaaaaacaattacaacaacaaccacaacaaatatcaaatgaaccaaaaattgat
tatttaaaaagaaaagaacataaaagacaattagtaattgctgctgaacattttaatcgt
aaaccaaatgatgctattgaatatttaaaaaataataatttatattcaccagttacacca
gaaaatattgcaaaatttttattggaagtaccaaaattaaataaaacaacagttggagaa
tatttaggtaaaagaggagaaatgaatgaaaaagttagaaatcattatattaattcattc
aacttaaagaatccaaattgtatgacagtatttagagagtttttagagagttttaagatt
cctggtgaatctgcagttgtacaaatcattttcgaagagtttgctcaaaagatttacgag
aatagatcagacaagttgtttttgaatgccgacaaggtttatctttacatttattcagca
ttgatgttacacacatctttatataatccagtgatctctcaaaaggagagaatgaaattt
tcaaactttaaatcaatgttaaataaagagttaccagatgaattgattcaagaatgtttt
gatgatatctcagagaatgaaatgatagtggaagaggagccacaacctggtgttataaat
caaccaaattggaggaaaattctaatgagatcaaaacgtattggtgattataaatctgca
aataccaatgattatgatcgtgaaatattttcaatagttttaaatttagttatacctgca
attagtaaagtatttgaaaagattgaaaatgaatcattatgtcaaagaattttagatggt
tttcatctatgtgctcaagtatctgcaaattataatatcattgaagtaattgataattta
atgacttcactttgtaataatacaactttaatcgataatactgttgaacaacagcaacaa
caacaacaatcaaatttaaataatacaaatcaaaataatgttaataataataatagtaat
gttaataataacaataataatgtaaatcaaaataatgttaataataataataataataca
aatataaataatataaatcaaaataatataaatcaaaataatttaaataatagtaataat
aataatttaataccgaatggtacaaattcaccatcatcaaatgtaacaacaccaaatcaa
caaacaacaacaacaacaacaacaaatagcggtactccattatctaatagtaatggaatg
aataataataataataataataataataataacactaataataataataataataattat
tattataatgaaaatgtatttattggtgataataaagcacaattagcaacgattgcaaca
tttgaaattgcaattaaatattccaatttattaggagaatcttggagatatataattgca
atcatttgtagattaaataaaatggatttattatcaaacatttttgaaactattgatttc
ccaattgataacacttcaaattcaaaaggtggtaagaaacaagaagaacaaaaacaaaaa
caaaattcaacatcaacatttttatcatttagatggtttgttgctgattcaactgattat
gaagaaattgaagtcattgatccacataaagagaaagctaaaacttgtgttgataattgt
catataactgatttatttcaagagactaaatcattaccaatgcattctttagatcaatta
ttaaattcattatttaatattacaaatccaacaaaacaacaatcttcttcttcttcttct
tcttcttcaacaacaacgacaacaacatcttcaacaagtaatataacaacaatagcaaca
gtacaaccatcaaccacaacatcatcatcatcatcattatcaactacatcatcatcatca
tcaacaataacaactacaaattcaccaacacaacaacatcatcataataattatcataat
cattatggtaatacatcaaatttttattattcaattaatcaaaaacaagaattattttgt
tttgatttattatcacatattatacttttaaatcaagatagattaggattagtatggaat
aaatattttgaacattgtgaatccattataaatatatttgaacaagtggttagtgtttca
actgccaatgcaagattaatgacaccattaatcgaaaaagtagtaatgtcaataatgtat
cttttaattagattaattagaaagaaagaggttttcagtactctatcagcttgtatcaaa
ttgttgttacgtgttggtaatgtattggatagtattgcagagaaaatgtcaatctcttta
attcaattggttcaaaagaatattgatttcctatcaactacaccatcagcttgggaacct
attttagcattgattgtacttttgtcaggtaatccaaaatcatcgaatcgtgcatgtgat
gctctatccttgatgattaaaactcaaccagactcgttgactgaggaaacttgtttacat
tgtttagagccaatcaattgtttcatcgattcaaagacaattccacatggtgtcgtagtg
aagtcaatggagttactctatttcatctttacaaatgtcactaaaatattgggtattcat
aagattgaaagtggtaccaatgatcattcttcaccaaatggtggaatggttggctttcaa
actactcgtattttaattagaaagatggatgtaaaaatcaatacggcttgggttaaattt
tggtcaaagatattggtgaaattctcttccctatgtttagatccaaaaccagatattaga
aacaacgctatgacattccttcaaaagacaatactctcctcatcgttacaagagttttta
ccaccaggtagatggtttgattgttttgttgatgtggttttccaactcttagataatctt
aaagagaattcaagagaaaccaatttcgaagatacaagattacgtgcttctgctttactc
tcaaaagtgttcttacaaaatttaaataccatcataaaatgtgatcaatttacaacccta
tgggatagtattttatctcatttgaaaatttatatgggtctatcggaattactctctgaa
tctgtaccagagtctcttaaaaatatgcttttggtaatgaataatagtggtgtatttaaa
ccaccaacaggtgaagaatcagaagatgatatctctaaacaactttgggattcaacttgg
gctgctattgatgaattttgtccaaaaattagtgaagatgttttatcacgtgttgatcca
aattatttcttaaaaaaacaacaacaacaacaacaacaacaacaacaacaacaacaacta
cagcaacagcaacaacaacaacaacactcacaaagtgaggaattaaaacaacaacaatta
ttatcacaaataattcaacaaaacattaattctccaacaattattgatactccaagtgtt
ttacaacaataccaacaaccacaactacaacaaccacaacaacctcaacaaccacaacaa
caagatcaagaagaatttaatccaattatgtcaattccaatggtaccaataatgccaaat
aatacaaataataatataaacaaataa

DBGET integrated database retrieval system