KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290779
Entry
DDB_G0290779      CDS       T00245                                 
Symbol
rabL
Name
(RefSeq) GTP binding protein RARE7L
  KO
K07976  Rab family, other
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ddi04031]
    DDB_G0290779 (rabL)
GTP-binding proteins [BR:ddi04031]
 Small (monomeric) G-proteins
  Rab Family
   Others
    DDB_G0290779 (rabL)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1
Other DBs
NCBI-GeneID: 8627830
NCBI-ProteinID: XP_635533
dictyBase: DDB_G0290779
UniProt: Q54FK7
Position
5:complement(4606115..4606894)
AA seq 204 aa
MKEEKTMLKIITLGDSNVGKTSLFYHYVNGEYRYNRPPSIGPDYFIKELKVENKHVFLMV
WDTCGQERFQAFSPPYFRGANCYTLCFDIHNEESFINLGKWMDEIIKYCYGNIPFVLVGT
KSDIPRTDKSISKARIEQWCKNIEDQGIIDKVHYFETSAKLSQNVTELYNVAAKLALEHY
SIVKYISIIRPIGPPEEVKVGTCC
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaaagaagaaaaaacaatgttaaagattataactcttggagacagtaatgttggtaaa
acatctctcttttatcattatgttaatggagaatatcgatataataggccaccctcaatt
ggacctgactattttataaaggaattaaaggttgaaaataaacatgtgtttttaatggtt
tgggatacctgtggtcaagaacgttttcaagcatttagtccaccttattttcgtggtgca
aattgttatacactttgttttgatattcacaatgaagaatcatttattaatcttggaaag
tggatggatgaaattataaagtactgctatggaaatattccatttgttttagtaggtaca
aaaagtgatattcctagaactgataaatcaatatcaaaggcaagaattgaacaatggtgt
aaaaatattgaagatcaaggaattatagataaagttcattattttgaaacatctgcaaaa
ctttctcaaaatgttacagaattatataatgttgctgcaaaactagctttggaacattat
agtatagttaaatatatctcaattattcgtccaattggtccgccggaagaagtcaaagtt
ggaacatgttgttaa

DBGET integrated database retrieval system