KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290957Help
Entry
DDB_G0290957      CDS       T00245                                 

Gene name
cprA
Definition
(RefSeq) cysteine proteinase 1
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ddi01002]
    DDB_G0290957 (cprA)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     DDB_G0290957 (cprA)
Peptidases and inhibitors [BR:ddi01002]
 Cysteine peptidases
  Family C1: papain family
   DDB_G0290957 (cprA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 DUF3619
Motif
Other DBs
NCBI-GeneID: 8627918
NCBI-ProteinID: XP_635417
dictyBase: DDB_G0290957
UniProt: P04988
Position
5
AA seq 343 aa AA seqDB search
MKVILLFVLAVFTVFVSSRGIPLEEQSQFLEFQDKFNKKYSHEEYLERFEIFKSNLGKIE
ELNLIAINHKADTKFGVNKFADLSSDEFKNYYLNNKEAIFTDDLPVADYLDDEFINSIPT
AFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEY
EGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYTAETGTQCNFNSANIGAKISNFTM
IPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVFDIPCNPNSLDHGILIVGYSAKNTIF
RKNMPYWIVKNSWGADWGEQGYIYLRRGKNTCGVSNFVSTSII
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatattattatttgttttagctgtttttactgtttttgtttcaagtagagga
attccattagaagaacaaagtcaattccttgaatttcaagataaattcaataaaaaatat
tcacatgaagaatatttggaaagatttgaaatttttaaaagcaatttaggaaaaattgaa
gaattaaatctaatagccattaatcacaaagctgatactaaatttggtgtaaacaagttt
gcagatctttccagtgacgaatttaaaaattattatttaaataataaggaagcaatattc
actgatgaccttccagttgctgattatcttgatgatgaattcattaattcaattccaact
gcatttgattggagaactagaggtgctgttacacctgtaaaaaatcaaggtcaatgtggt
agttgttggtcattttcaactactggtaatgttgagggacaacatttcattagtcagaat
aaattagtttcattatcagagcaaaacttggtagattgtgatcatgagtgtatggaatat
gaaggtgaacaagcttgtgatgagggttgtaatggtggtcttcaaccaaatgcatataat
tatatcattaaaaatggtggaattcaaacagaatcttcatatccttacactgctgaaaca
ggtacacaatgtaactttaactctgccaatattggtgcaaagatttccaattttacaatg
atcccaaagaatgaaactgtaatggctgggtacatcgttagtactggaccactcgcaatt
gctgctgatgctgttgagtggcaattttatattggtggtgtatttgatattccatgtaat
ccaaattcacttgatcatggtattttaattgttggttactctgctaaaaatacaattttc
cgtaaaaatatgccatattggattgtaaagaattcttggggtgcagattggggagaacaa
ggatacatttatttaagaagaggaaagaatacatgtggtgtatcaaactttgtttcaact
agtataatttaa

DBGET integrated database retrieval system