KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290961
Entry
DDB_G0290961      CDS       T00245                                 

Symbol
zfaA
Name
(RefSeq) RING zinc finger-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: zf-TRAF MATH zf-C3HC4_3 zf-C3HC4_2 zf-TRAF_2 zf-RING_2 Sina
Other DBs
NCBI-GeneID: 8627917
NCBI-ProteinID: XP_635416
dictyBase: DDB_G0290961
UniProt: P11467
Position
5
AA seq 460 aa
MSIDIKFTINDILFNQESLQKKNKYTCPICFEFIYKKQIYQCKSGHHACKECWEKSLETK
KECMTCKSVVNSYNDLSRCLMVERAFDKKECCCIYSFNEQIVEGGTNCSPPDGASDQNQR
KLIKDEENGCKEKIEVDQIDSHLINCQYKFVTCSFKGCEKILRMNSLESHQNECGFKLVT
CDFCKRDDIKKKELETHYKTCPMVPIDCSQGCSVKIERKSIIDHIENDCCNTQIPCKYFE
QGCKVEMKRSELQNHLERVNHQNYMGILIEKLTNQVGQSKKTHDELLKKIEDLSLLVIKF
SDACLKKQVLPKALDICSNGYRNKWIISNYSSVAKSKLNCQALSSPMLSILSHLFQVCVY
PKGDENKEYISLYLRVNNIEEPNSLKVEYSFTLVNVLDKSKSITKKEDKKVFISSEGWGW
GKFLLSDLINKENGWLSNDDKLIIEIYIKILNEEYEPLES
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgtcaattgatataaaatttacaattaatgatattttatttaatcaagaatcattacaa
aagaaaaataaatatacatgtccaatttgttttgaatttatttataaaaaacaaatttat
caatgtaaatcaggtcatcatgcatgtaaagaatgttgggagaaatcattagaaacaaaa
aaagaatgtatgacttgtaaatcagtagtgaattcatataatgatttatcaagatgtttg
atggtagagcgtgcatttgataaaaaagaatgttgttgtatttactctttcaatgaacaa
atcgttgaaggtggaacaaattgttcaccaccagatggtgcctcagaccaaaatcaaaga
aaattaataaaagatgaagaaaatggttgtaaagaaaaaattgaagttgatcaaattgat
tctcatttaatcaattgtcaatataaatttgttacatgttcattcaaaggatgtgaaaag
attttaagaatgaattcgttagaatctcatcaaaatgaatgtggtttcaaattggttaca
tgtgatttctgtaaaagggatgatattaaaaagaaggaattagaaactcattataagaca
tgtcctatggttccaattgattgctcacaaggttgttcagtgaaaattgaaaggaaatca
attatcgatcatattgaaaatgattgttgtaatactcaaataccatgtaaatattttgaa
caaggttgtaaagttgagatgaagagatcagaattacaaaatcatttggagagagtgaat
catcaaaattacatgggcattctaattgaaaaattaacaaatcaagttggccaatcaaag
aaaactcatgatgaacttttgaaaaagattgaagatttgtcattattagttatcaaattc
agtgatgcatgtttaaagaaacaagttcttccaaaggctttggatatttgttcaaatggg
tatagaaataaatggatcatttcaaactattcaagtgtagcaaaatcaaaattaaattgt
caagcattgtcctctccaatgttgtcaatactctctcacctttttcaagtttgtgtttat
cctaaaggtgatgaaaataaagagtacatttcattatatttaagagttaataacattgaa
gaaccaaactcattaaaagtagaatattcatttacattagtcaatgttttggataaatca
aaatcaattacaaaaaaagaagataaaaaagtttttataagttcagaaggatggggatgg
ggaaaattcttattatctgatttaattaataaagaaaatggttggttaagtaatgatgat
aaattaataatagaaatttatattaaaattttaaatgaagaatatgaaccattggagtct
taa

DBGET integrated database retrieval system