KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291077
Entry
DDB_G0291077      CDS       T00245                                 

Gene name
rdiA
Definition
(RefSeq) hypothetical protein
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0291077 (rdiA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0291077 (rdiA)
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0291077 (rdiA)
  Exosomal proteins of colorectal cancer cells
   DDB_G0291077 (rdiA)
SSDB
Motif
Pfam: Rho_GDI DUF3324
Other DBs
NCBI-GeneID: 8627980
NCBI-ProteinID: XP_635396
dictyBase: DDB_G0291077
UniProt: Q95UQ1
Position
5
AA seq 197 aa
MSDNHEEESNVPAYVPGKHVSVDQLKQQDAEDEALKRYKESLLGTGVHAPKDDPRKLVIK
EMKIQIEGRPDTIYPLDTKELIKEMKTKPFVLKESCHYKITLTFNIQHDIVSGLKQTNTV
YRKGIKVSTEKHMLGSFAPQALAHSVTNPRHGWEEAPSGMLARGSYTAKVVFTDDDNEEH
LSVEYAFSIKSDWKSDD
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtcagataatcacgaagaagaatcaaacgtaccagcctacgtcccaggtaaacacgtt
tcagtcgatcaattaaaacaacaagatgctgaagatgaagcattaaaacgttataaagaa
tcacttttgggtactggtgttcatgccccaaaggatgacccaagaaaattggttatcaaa
gaaatgaaaatccaaatcgaaggtagaccagatactatttatccactcgacacaaaagaa
ttaattaaagaaatgaaaaccaagccattcgttctcaaggaatcatgtcactacaagatc
accttaacttttaacattcaacacgatatcgtttctggtctcaaacaaaccaacactgtc
tacagaaaaggtatcaaagtttcaactgaaaaacacatgcttggttcatttgccccacaa
gctcttgctcactctgtcaccaacccaagacatggttgggaagaagctccatcaggtatg
ttagctcgtggtagttacaccgccaaagtcgttttcactgatgatgataacgaagaacat
ttatcagttgaatatgctttctcaattaaatctgactggaagagtgatgattaa

DBGET integrated database retrieval system