KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291267Help
Entry
DDB_G0291267      CDS       T00245                                 

Gene name
dst3
Definition
(RefSeq) STE20 family protein kinase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal DUF3450
Motif
Other DBs
NCBI-GeneID: 8628053
NCBI-ProteinID: XP_635106
dictyBase: DDB_G0291267
UniProt: Q54EY4
Position
6
AA seq 562 aa AA seqDB search
MNSDSVENLFISRISKDDPEAIFQIVEVVGSGSFGTVCACRWMKKKDRESNGNRLIACKF
VEVNADDVETNLNLVKEIDILKESMDCPYIVEYKGCYLKSSMLLIVMEYCKGGSLLDIIE
LCGKRLIEEEIAAVCAGVVKGLVYLHSKRTTHRDIKAGNVLLDEEGLPKLADFGVSTIAE
QGQKMNTVIGSPYWMAPEIIMGQGYDQKADIWSLGITAIEIAELVPPRFDVPPSRVIFTI
PHQPPPSLKIPSDWSPEFNDFVKQCLSMNPALRPSAQQLLSHPFILKGSSQQILQKLVNE
SIPLLKEKRAEKIRQLEEQEQQRNSSGSKMVSSVPTRASQALTNVRNAESLKGSVVILNS
NTKTASIMRNKNPQPPPPSHSSGAGGAAGSTRRVPGNKSVLNRYPPANNVSNGTIAPSPI
NNNNNNNNTTTKVGKVSSPFLQQQQQQQQQNNNKNPPPKPTTPSPNKKIGDNISKTTPTT
PTTTQPNTSTTTKTGSSLNIKPTNNVNRSTISIGQQKSPLQSSEREASYDEESVSVIYHG
SEDEEDEEEFNHEDYEEINVNI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagattcggttgaaaatttatttatttcaagaatatcaaaggatgatccagaa
gcaatatttcaaattgtagaagtagttggatcaggatcatttggtacagtttgtgcatgt
agatggatgaaaaagaaggatagagaatccaatggcaatagattgatagcatgtaaattt
gtagaggttaatgcagatgatgtagagaccaatttgaatttagtgaaagagattgacatt
ttgaaggaatcaatggattgtccatacattgtagagtataaaggttgttatttaaagtca
tctatgcttttaattgttatggaatattgtaagggtggttcattattggatattatagag
ttatgtggtaaaagattgatagaggaagagattgcagcagtttgtgcaggtgttgtaaag
ggattggtttatcttcattcaaaacgtaccactcatcgtgatatcaaagctggtaacgtt
ttattggacgaagaaggtttacctaaattagccgatttcggtgtatcaacgatcgctgaa
caaggtcaaaaaatgaacactgttattggttcaccctattggatggcaccagagatcatt
atgggtcaaggttatgatcaaaaggctgacatttggtcattgggtatcaccgcaattgaa
atcgccgaattggtaccaccaagattcgatgtaccaccttcacgtgtaatctttaccata
cctcatcaaccaccaccttcccttaagataccctctgattggtcaccagagtttaatgac
tttgttaagcaatgtctctcaatgaatcctgcacttcgtccttctgctcaacaattgtta
agtcatccttttattctcaaaggttcctctcaacaaattctacaaaaattagtcaatgaa
tcaatacctctactcaaagagaagcgtgctgaaaaaattagacaactcgaagaacaagaa
caacaaagaaatagtagtggtagtaaaatggtctcaagtgtaccaactagagcctctcaa
gctttaacaaatgttagaaacgctgaatctttaaagggttctgttgtcatcttaaattca
aatacaaaaaccgcttccatcatgcgtaacaaaaatccacaaccaccaccaccttctcat
agtagcggtgctggtggtgctgctggttcaacaagaagagtgcctggtaataaaagtgtt
ttaaatagatatccacctgcaaataatgttagcaatggaactatagctccctctcctatt
aataataataataataataataatactactactaaggttggtaaagtaagctctcctttc
cttcaacaacaacaacaacaacaacaacaaaataataataaaaatcctccaccaaaacca
acaacaccatctccaaataaaaaaattggtgataatatatcgaaaactactccaacaact
ccaactacaacacaacccaatacctcaactactaccaaaactggaagtagtttaaatatt
aaaccaactaataacgtaaatagaagtaccattagtataggtcaacaaaaatcaccactt
caaagctctgaaagagaggcatcatatgatgaagaaagtgttagtgttatttatcatggt
agtgaggacgaagaagatgaggaagagtttaatcatgaagattatgaagaaattaatgtt
aatatataa

DBGET integrated database retrieval system