KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291293
Entry
DDB_G0291293      CDS       T00245                                 

Symbol
rabU
Name
(RefSeq) Rab GTPase
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: Ras Roc
Other DBs
NCBI-GeneID: 8628068
NCBI-ProteinID: XP_635121
dictyBase: DDB_G0291293
UniProt: Q54EW9
Position
6
AA seq 194 aa
MEKKKNLEQDCIFRIVIIGYDYECGIKSLLKKFTLGEFSPFPESQVGVDFDIKTINVDNQ
DIKLQIWPQNKYFNDTSDKRDFLYKGAHGYLLVYGCHSQKSFDNLLNDWMVQIDKFSNEF
SKRNLVLVCNNSETPETYMTKPNYLVDSNITKQWANSKNIPFFEINPKENFNVDEPFIQL
ARLIKNQNFINSTK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggaaaaaaaaaaaaatttagaacaagattgtatttttagaatagttattattggatat
gactatgagtgtggtataaaatcgttattaaaaaagtttactttgggagagttttcacca
tttcctgaaagtcaggttggtgtagactttgatattaaaactataaatgttgataatcaa
gatattaaacttcaaatttggccccaaaataaatattttaatgacacttcagataaaaga
gatttcctttacaagggagcccatggatatttattagtgtatggatgtcatagccaaaaa
agttttgataatctattaaatgattggatggttcaaattgataaattttcaaatgaattc
tctaaaaggaatttagttttggtttgtaataattctgaaactcctgaaacatacatgacc
aaaccaaattaccttgttgattccaatattaccaaacaatgggcaaattcaaaaaatatt
cctttttttgaaattaacccaaaagagaactttaatgttgatgaaccttttatacaactt
gcaaggctaattaaaaaccaaaattttattaattctaccaaatag

DBGET integrated database retrieval system