KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291836
Entry
DDB_G0291836      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K22611  squamous cell carcinoma antigen recognized by T-cells 3
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0291836
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0291836
Spliceosome [BR:ddi03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    DDB_G0291836
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    DDB_G0291836
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 8628356
NCBI-ProteinID: XP_629950
dictyBase: DDB_G0291836
UniProt: Q54E37
Position
6
AA seq 949 aa
MSDINEDEYNDEEMKAVLKEDSSDSSDDYENNNEDLSNSSDDDDDDDDDGDDSSDDDDDD
NMESKTDYENSSEGLEVGLLEIKLREDPYSFEKNLNYINALSKFTKQSNYQTLREAREKF
QSIHPLSQDIWLAWFSDEQKYMKTDNDKQYILSLYEKALNDFISVKINVSYCKFIIKINT
NSGGLINNVKEIRKQFERSLEQCGDDIIESPLLWSEYRMFEQMLLSQIKDDKEKQTQIKI
IRDLYHRQLSNPMIGLHSIYNDYQQWEHSQSIDNNNNNNNNQEKEKEEKEKEEKEIKLKF
EKSLKQFKEREPFEIALKEKKYLDQRKWKEYIEFEKQQQHNDKPMRVATLFERQLKSFSN
HFSIWSFYLTYLEKFTNFKDLHLKVFSRSLRSIYYSGEHWSKYLLLLEERVHNDNDNDKR
VKIEQEFQRSLVSGLKSEYDYQLVYNTYIDYNWRSIIKKLNTDSNANSNGNGNNNNNNNN
NNNNNNNNNNNNNNNNNNNNSISENDKQLMKSLFETMNNQMSTIDVNNYTTVDRYMYIAQ
FEWRQFNDLSRYREIVDYVLSIDPSQYWIWCQYISFEMEQKQFQSVRELFKKASSHIRFD
DPSSRIWQDWFTFERGYGDINQYRAVSDRYSIIQNKYNKEQERYLQQQQQQQQKQQQQNK
RKEKDDGKNKDEKRISKKQKNENHKEKGDQDEFKKPLPPTSKKEKEKEKDLPKKLIILNL
SFDTAEPDLHKIFDKYGQIKSLKLVLDKNGKSKGICFILYKSHESANKALEMDQQIIKNR
TICVQYSKDQQINDHVESNQTLTTTATTTTTTNEIDFENHIGLTVFINNLSPSVNKEKLE
QFLRHNGVTGIKDIRVVLKARPFAYIDLIDKENLKKALSLDKKYFLSKLINVNLSKPPSS
ISPANNNNDNNNNNNNNTITSNGNDTEFIKEIPSRKPTLLVPRGIKNKK
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgtcagacataaatgaagatgaatataatgatgaagaaatgaaggcagtattaaaagaa
gattcaagtgattcatcagatgattatgaaaataataatgaagatttatcaaactcaagt
gatgatgatgatgatgatgatgatgatggcgatgattcatcagatgacgatgatgatgat
aatatggaaagtaaaactgattatgaaaattcatcagaaggattagaggttggattactt
gaaattaaattaagggaagatccatattcatttgaaaagaatcttaattacattaatgca
ttatcaaaattcactaaacaaagtaattatcaaacattaagagaagcaagagaaaagttt
caatcaattcatccactctcacaagatatttggttagcttggttttctgatgaacaaaaa
tatatgaaaactgataatgataaacaatatattttatctctatatgaaaaagctttaaat
gatttcattagtgtaaaaattaatgtatcttattgtaaattcattataaagattaataca
aattcaggaggattgattaataatgttaaagagattagaaaacaatttgaaagatcatta
gaacagtgtggtgatgatattattgaatcaccattattatggtcagaatatagaatgttt
gaacaaatgttattatcacaaataaaggatgacaaagagaaacaaacacaaattaaaatc
attagagatttatatcatcgtcaattatctaatccaatgattggtttacattcaatttat
aatgattatcaacaatgggaacattctcaatctattgataacaataataataacaataat
aaccaagaaaaagaaaaagaagaaaaagaaaaagaagaaaaagaaattaaattaaaattt
gaaaaatcattaaaacaatttaaagaaagagaaccatttgaaatagcattaaaagaaaag
aaatatttagatcaaagaaaatggaaagaatatattgaatttgaaaaacaacaacaacat
aatgataaaccaatgagagttgcaacattatttgaaagacaattaaaatcattttcaaat
catttttcaatttggtcattttatttaacatatttagaaaagtttacaaactttaaggat
ttacatttgaaagttttctcaagatcattacgttcaatttattattctggtgaacattgg
tcaaaatatttattattattagaagagagagttcataatgataatgataatgataaaaga
gtaaaaattgaacaagaatttcaacgttcacttgtatctggtttaaagagtgaatatgat
tatcaattagtttataatacatatattgattataattggagatcaattattaaaaaactc
aatactgatagtaatgctaatagtaatggtaatggtaataataataataataataataat
aataataataataataataataataataataataataataataataataataataataat
agtatttcagaaaatgataaacaattaatgaagtcgttatttgaaactatgaataatcaa
atgtcaacaattgatgttaataattatacaacagttgatagatacatgtatatagctcaa
tttgaatggagacaattcaatgatttatcaagatatagagagatagttgattatgtttta
tcaattgatccatcacaatattggatttggtgtcaatatatttcctttgaaatggagcaa
aaacaatttcaatcagtaagagaattgtttaaaaaagcatcttctcatattagattcgat
gatccttcttcaagaatatggcaagattggttcacttttgagcgtggctatggtgatatt
aatcaatatagagcagtctctgatcgttattctattattcaaaataaatataacaaagag
caagaaagatatcttcaacaacaacagcagcaacaacaaaaacaacaacaacaaaataaa
agaaaagaaaaagatgatggaaaaaataaagacgaaaaaagaatatcaaagaaacaaaag
aatgaaaatcataaagaaaaaggagatcaagatgaatttaaaaaaccattacctccaaca
tcaaaaaaagaaaaagaaaaagaaaaagatttaccaaagaaattaattatactaaattta
tcatttgatacagcagaacctgatttacataaaatctttgataaatatggtcaaattaaa
tctttgaaattagttttagataagaatggaaaatctaaaggaatttgtttcattctttac
aaaagtcatgaatctgcaaataaagcattagaaatggatcaacaaattattaaaaataga
actatttgtgttcaatattcaaaagatcaacaaattaatgaccatgtcgaatcaaatcaa
actttaacaacaacagcaacaacaacaacaacaacaaatgaaattgattttgaaaatcat
attggtttaacagtatttattaataatttatcaccaagtgtaaataaagaaaaattggaa
caatttttacgacataatggtgtaactggtattaaagatattagagtggtattaaaagct
agaccatttgcctatatagatttaattgataaagagaatttaaagaaagcattatcatta
gataaaaaatattttttgagtaaattaattaatgttaatttatcaaaaccaccatcttct
atttcacctgcaaataataataatgataataacaataacaataacaataatacaataact
tcaaatggaaatgatacagagtttattaaagaaattccaagtagaaaaccaactctctta
gtaccaagaggaataaaaaataaaaaataa

DBGET integrated database retrieval system