KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291928Help
Entry
DDB_G0291928      CDS       T00245                                 

Gene name
ubqI
Definition
(RefSeq) hypothetical protein
  KO
K08770  ubiquitin C
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0291928 (ubqI)
Ubiquitin system [BR:ddi04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   DDB_G0291928 (ubqI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 Methyltrans_RNA
Motif
Other DBs
NCBI-GeneID: 8628425
NCBI-ProteinID: XP_629924
dictyBase: DDB_G0291928
UniProt: P0CG80 P0CG88
Position
6
AA seq 305 aa AA seqDB search
MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttttgttaaaactctcactggtaaaactatcaccttagaagttgaaggttca
gataatattgaaaatgttaaagccaagattcaagataaagaaggtattcccccagatcaa
caaagattaattttcgctggtaaacaattagaagatggtcgtactctttcagactataat
attcaaaaagaatcaactcttcatttagttttaagattaagaggtggtatgcaaattttc
gtcaaaactcttactggtaaaaccatcacattagaagtcgaaggtagtgacaatattgaa
aatgttaaagccaaaattcaagataaagaaggtattcccccagatcaacaaagattaatt
ttcgctggtaaacaattagaagatggtcgtactctctctgattataatattcaaaaagaa
tcaactcttcatttagttttaagattaagaggtggtatgcaaatttttgttaaaactctc
actggtaaaactatcacattagaagtcgaaggtagcgacaacattgaaaatgttaaagcc
aaaattcaagataaagaaggtattccaccagatcaacaacgtctcatttttgctggtaaa
caattagaagatggtcgtactctttcagattacaatattcaaaaagaatcaactcttcat
ttagttttaagattaagaggtggtatgcaaatctttgttaaaactttaacaggtaaaact
atcactttggaagttgaaggttcagataatattgaaaatgtaaaagccaaaattcaagat
aaagaaggtatcccaccagatcaacaaagattaattttcgctggtaaacaattagaagat
ggtcgtactctttcagactataatattcaaaaagaatcaactcttcatttagttttaaga
ttaagaggtggaaattaa

DBGET integrated database retrieval system