KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291994
Entry
DDB_G0291994      CDS       T00245                                 

Gene name
abcA1
Definition
(RefSeq) ABC transporter A family protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 AAA_15
Other DBs
NCBI-GeneID: 8628469
NCBI-ProteinID: XP_629792
dictyBase: DDB_G0291994
UniProt: Q8T5Z7
Position
6
AA seq 877 aa
MSTYSRYNDEDEIRNNKISFGDNIKREFLHLKLLLKKNLLVSIRSYFSTGIEILSPIAFI
IILFLISHFGSGNENPIVTYNQELPICKSYGENRCFNIMFSPSNSPSAIAIMEMLGEINN
NSIYSYPSDTGYLPDLNNTIGLKGGLIMMNSIEDSFEFVLAHPNVTIAAVDFLSIPLGFQ
INGAPPKNEPLLKMDGNSLEFNVVVNTTCPNILATCPDYSIAITTAIEKAVITYYSQKIR
NEKIPPPTISYGSNAFPRYPPEQGAARVWGGLFYYCGSMISFIFLLYKVSFEKENKLKQG
MVMMGLSVNQYWISWFITSFTIDILISLITIIVGLACQLPFFLGSNFFVLIITFSLFTIS
MSSVAFFLLTFIQSTKSAIGIGMGIFIVGSIFQLVFSGMGTMIFELIYQTNSNGALAARI
ILFFIPMFHFTKVLTDIGNVTTNYPLLTYKFSDLSTDLNIGGTVLKTVIPTTGQSICYLL
ALIGVYTVLAWYFEHIIPGNDGTSSPPWFFVLPSYWGLSLKKVRHIPTPYFDDEDVRAAI
TKAHDASNRAPLIICGLSKSYTKLFRPKKTVHAVKYLSLSVEKGTILGFLGSNGCGKSTT
IGMLTGLLEPTAGDALVYGHSVISNIAAVRRITSVVPQHDILWAEMTAREHLQLFSELKG
IPAQERESQIQKVLDQVRLSKISNNLISTYSGGMKRRLSVAIACIGDPKIIFMDEPTTGV
DPSSKRHLIDLVKSIKNDKVIILTSHDMHEVEILADKIVIMNEGVMACNGNSLQLKSKYG
EGYSVNIVAKSPESIPAVVEFVTLSIPGCKFMKQSALQLNFGFPVTIDHQIIANFFKQLE
EITNDPNNQLMRDWSVSHSTLDDVFLKVSHLAKLKTQ
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgtcaacatattcaagatataatgatgaagatgaaataaggaataataaaatttcattt
ggtgataatattaaaagggaatttttacatttaaaattattattaaaaaagaatttatta
gtctcaataagatcatacttttcaactggtattgaaattttatcacctattgcttttatt
ataattttatttttaatttctcattttggttctggtaatgaaaatccaattgtaacatat
aatcaagaattaccaatttgtaaatcatatggtgaaaatagatgttttaatattatgttt
tcaccaagtaattcaccatcagcaattgcaattatggaaatgttaggtgaaattaataat
aatagtatttatagttatccaagtgatacaggttatttaccagatttaaacaatactatt
ggattaaaaggtggtttaattatgatgaattcaatagaggattcatttgaatttgtatta
gcacatccaaatgttacaattgcagcagttgatttcttatcgattccacttggatttcaa
attaatggtgcaccacccaaaaatgagccattgttgaaaatggatggaaattcattggaa
ttcaatgtggttgtaaatacaacatgcccaaatattttagctacatgtccggattattcg
attgcgataacaacagctattgaaaaggctgttattacatattactcacaaaagattaga
aatgaaaagataccaccaccaacaatctcctatggctcgaatgcgttcccacgttatcct
ccagaacagggggcagcaagggtttggggtggcttattctattattgcggttcaatgata
tcattcatatttttattatacaaagtgtcgtttgagaaagagaataaattgaaacagggt
atggttatgatggggttgagtgtcaatcagtattggattagttggttcattacaagtttc
accattgatatattgatatcgttgattaccattatcgttgggttggcatgtcaattacca
ttctttttgggtagcaatttctttgtattgataatcacattttcattattcacaatatca
atgtcatcagtggccttcttcctcctaacctttattcaatccacaaagtcagcaatagga
attggtatgggtatattcatcgttggttcaatctttcaattggtattcagtggtatgggt
actatgatctttgaattaatctatcaaaccaacagcaatggtgcattggctgcaagaatt
atacttttctttataccaatgtttcatttcactaaagttctaactgatattggtaatgtt
acaacaaactatccactacttacttataagttctctgatctttcaacagatttaaatatt
ggtggtactgtattgaaaactgtaattccaacaactggtcaatcaatttgttatctattg
gcattaattggagtttatacagtattggcatggtatttcgaacatattataccaggtaac
gatggtacatcctctccaccatggttttttgttttaccatcctattggggtttatcatta
aagaaagtacgtcatattccaacaccatatttcgatgatgaggatgttagagctgcaata
accaaagcacatgatgcttcaaatcgtgcaccattaatcatttgtggtttatcaaagagt
tatactaaacttttcagaccaaagaaaacagttcatgccgttaaatatttatcattatcc
gttgaaaaaggtacaattcttggtttcttgggttcaaatggttgtggtaaatcaacaaca
attggtatgttaactggtttacttgaaccaactgctggtgatgctttggtctatggtcat
agtgtcattagtaatattgctgccgttcgtagaattacttcagtagtaccacaacatgat
attctttgggcagaaatgacagctagagaacatttacaactattctctgaattgaagggt
atcccagcccaagaaagagaatctcaaattcaaaaggttttagatcaagttagattatca
aaaatttcaaataacctaatctcaacctattcaggtggcatgaaaagaagactctctgtt
gcaatcgcttgcattggtgatcctaaaatcatctttatggatgaacctaccactggtgta
gatccttcctcaaagagacatttaatagatttagtaaagagtatcaaaaatgataaagta
ataattctcacctctcatgatatgcatgaggttgagattttggccgacaaaatcgtcatt
atgaatgaaggtgtaatggcatgcaatggtaattcattacaattgaaatcaaaatatggt
gaaggttattcagttaatatcgtagccaaatcgcccgaatccatacctgctgtagttgaa
tttgtaactctttcaattccaggttgtaaatttatgaaacaatccgctttacaattaaat
tttggtttccctgtaacaattgatcatcaaatcattgcaaactttttcaaacaattagaa
gaaattacaaatgatccaaataatcaattaatgagagattggtctgtttcacattctaca
ttggatgatgtatttttaaaggtttctcatttagcaaaattaaaaacacaataa

DBGET integrated database retrieval system