KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292104Help
Entry
DDB_G0292104      CDS       T00245                                 

Gene name
tkrA
Definition
(RefSeq) 2-keto-D-gluconate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00030  Pentose phosphate pathway
ddi00260  Glycine, serine and threonine metabolism
ddi00620  Pyruvate metabolism
ddi00630  Glyoxylate and dicarboxylate metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DDB_G0292104 (tkrA)
   00620 Pyruvate metabolism
    DDB_G0292104 (tkrA)
   00630 Glyoxylate and dicarboxylate metabolism
    DDB_G0292104 (tkrA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDB_G0292104 (tkrA)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     DDB_G0292104 (tkrA)
    1.1.1.81  hydroxypyruvate reductase
     DDB_G0292104 (tkrA)
    1.1.1.215  gluconate 2-dehydrogenase
     DDB_G0292104 (tkrA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN Sacchrp_dh_NADP F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 8628512
NCBI-ProteinID: XP_629831
dictyBase: DDB_G0292104
UniProt: Q54DP1
Position
6
AA seq 334 aa AA seqDB search
MTSIKNNNENKHIVVYRKIHQSLIEKLENQGYKVTQFEPINSNNIQEFYEAIKTANGLIG
SVFKIDENVLSKAPFLECVSAISVGYDNYDLVVLNDRKIPLMHTPNVLNDSMADIMMGLM
ITVARKLAYCDKRMRNGEWNGPLDKSWFGLEVHHKKVGIIGMGRIGEVLAKRCRMGFDME
VAYYSRSRHLKVEELYDAKHQDLDTILSTSDFICVVLPGSQETKHFFSFGQFSKMKNSAI
FINAGRGMTVDEVALIDALETGKIAGAGLDVFEKEPLNKDSKLLTLDNIVLLPHIGTSTI
ETQHIMSECAVNNLISALNGNLEKNCVNASIIKK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaattaaaaataataatgaaaataaacatattgtagtatacagaaagattcat
caaagtttaattgaaaaacttgaaaatcaaggctacaaagtgacacaattcgaaccaata
aatagtaataatattcaagaattttatgaagcaataaagacagctaacggtttaattgga
tcagtatttaaaattgatgaaaatgtattatcaaaagcaccatttttagaatgtgtttca
gcaatttcagtgggatatgataattatgatttggtagtattaaatgatagaaaaatacca
ttaatgcatacaccaaatgtgttgaatgactccatggctgatattatgatgggtttaatg
ataacagttgccagaaaattagcatactgcgacaaacgtatgcgtaatggtgaatggaat
ggaccattggataaaagttggtttggattagaagttcatcataaaaaagtgggtattatc
ggtatgggtagaattggtgaagttttggccaaacgttgcagaatgggcttcgacatggaa
gtggcctactattctcgtagtagacatttaaaagttgaagaactttatgatgcaaaacac
caagatttagatacaatcctttcaacaagtgatttcatttgtgtagttttaccaggatca
caagaaactaaacatttctttagttttggccaattttcaaaaatgaaaaactctgcaatt
ttcattaatgctggtagaggtatgacagttgatgaagttgcattaatagatgctttagaa
actggtaaaatcgctggtgcaggtttagatgtttttgaaaaagaaccattaaacaaagat
tcaaaactattaacattagataatatagtattattaccacatattggtacaagtacaatt
gaaacccaacacataatgtcagaatgtgctgtcaataatttaatttctgcacttaatggt
aatttagaaaagaattgtgtaaatgcatcaataattaaaaaataa

DBGET integrated database retrieval system