KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292134Help
Entry
DDB_G0292134      CDS       T00245                                 

Gene name
bub3
Definition
(RefSeq) WD40 repeat-containing protein
  KO
K02180  cell cycle arrest protein BUB3
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0292134 (bub3)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0292134 (bub3)
Spliceosome [BR:ddi03041]
 Complex A
  Other components
   Complex A specific factors
    DDB_G0292134 (bub3)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     DDB_G0292134 (bub3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Frtz
Motif
Other DBs
NCBI-GeneID: 8628531
NCBI-ProteinID: XP_629851
dictyBase: DDB_G0292134
UniProt: Q54DM1
Position
6
AA seq 331 aa AA seqDB search
MSNEPTSSFYELRLPPSDGISSVNFCPNSVNLLVTSWDSTVRCYDTQNNVQKWQYNHKGP
VMDGCFPEKNKVFSGDVFGSVKHYDPVAGVEKEVGSHEDGVRSVVYNSDTQQLFTGGWDQ
QLKLWDIRSDKMEISNHDLQSKIFTMDVSPISNMLVIGTADKYVTIYDTRQMETHLQKRE
SSIKYQTRCIRTFTDGKGYALASVEGRIAMEYFDPSPAVQSKKYAFKCHRLTESGVDVVY
PVNCIAFNPHYGTFATGGCDKNVFFWDGANRKRLHALKTYPTSISSMSFNTDGNILAVAS
SYTFEEGEKDHPPDQIFIHNILSEKIIKPIK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgaaccaacatcatcattttatgaattaagattaccaccttctgatggtatt
tcatcagtaaacttttgcccaaactctgtaaatttattagtaacatcatgggatagtaca
gttagatgttatgatacacaaaataatgtacaaaaatggcaatataatcataaaggacca
gtgatggatggatgttttccagagaagaataaagtattttcaggagatgtttttgggagt
gtaaaacattatgatccagtagcaggtgttgaaaaagaggtaggtagtcatgaggatggt
gtaagatcagtggtttataatagcgatacacaacaattgtttacaggtggttgggatcaa
caattgaaactatgggatatacgtagtgacaagatggagatatccaatcacgacttacag
tcgaaaatattcacaatggatgtcagtccaatttcaaatatgttggtcattggcactgca
gataaatatgtaaccatatatgacactcgtcaaatggaaacacatttacaaaagagggaa
tcctcaattaaatatcaaacaagatgtatacgtactttcacagatggcaaaggatatgca
ttggcctcggtggagggtcgtattgcaatggaatatttcgacccttcccctgcggtacaa
tcaaagaaatacgctttcaaatgtcatcgtttaaccgaatctggtgtagatgtggtttat
cctgtaaattgtatcgctttcaatccccattatggcacctttgcaactggtggttgcgat
aaaaacgttttcttctgggatggtgcaaatcgtaaacgtttacatgctttaaaaacttat
ccaacttcaatctcttcaatgtctttcaatactgatggtaatatattagctgttgcttct
tcttatacttttgaagaaggtgaaaaagatcatccacctgatcaaatttttattcataat
attttaagtgaaaaaattataaaaccaataaaataa

DBGET integrated database retrieval system